DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and OPCL1

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_564115.1 Gene:OPCL1 AraportID:AT1G20510 Length:546 Species:Arabidopsis thaliana

Alignment Length:548 Identity:139/549 (25%)
Similarity:247/549 (45%) Gaps:40/549 (7%)


  Fly    11 SRTWFGPRGKDFYG--------PEMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARI 67
            ||:.|......||.        |..:|........|.:..::..|..:|||.||..:|.:....:
plant     6 SRSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFISSQAHRGRIAFIDASTGQNLTFTELWRAVESV 70

  Fly    68 AQAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPI---NPLHPEFTEETVKYMYDITEPKV 129
            |.....:|:|:|.||.:.:.||.....|.::.:..|..|   |||:.  :.|..|.:.| :.|.:
plant    71 ADCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNT--SNEIAKQIKD-SNPVL 132

  Fly   130 IFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDIS---EMLNDEDSITAAAYVPCPKLHGDH 191
            .|...:   ::..::...:....:.:...:::.|.|:.   ||:..|.|.....    .::..|.
plant   133 AFTTSQ---LLPKISAAAKKLPIVLMDEERVDSVGDVRRLVEMMKKEPSGNRVK----ERVDQDD 190

  Fly   192 TAFIVCSSGTTGMPKGVTRSHRSLLCNCKN-PNTYTRDSVLLSF---SPLYWISGTIILLASLLN 252
            ||.::.|||||||.|||..|||:|:...:. .|.:..|.....|   .|::.|.|.......||.
plant   191 TATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFGSDDGEQRFICTVPMFHIYGLAAFATGLLA 255

  Fly   253 GCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIRVLIGAGSKV 317
            ....||....:.:..::..:.:::.|.|.|.. .|.:...:.:|.::.|..|.|:..::..|:.:
plant   256 YGSTIIVLSKFEMHEMMSAIGKYQATSLPLVP-PILVAMVNGADQIKAKYDLSSMHTVLCGGAPL 319

  Fly   318 CKAVCRRMYELIGNQRFVVGYGLSEMGGLSKNV-----GGPVGCEGKVMRNVELRVLDKLK-MPL 376
            .|.|.....|.....:.:.||||:|..|:..:.     ....|..||:..::|.|::|.:. ..|
plant   320 SKEVTEGFAEKYPTVKILQGYGLTESTGIGASTDTVEESRRYGTAGKLSASMEGRIVDPVTGQIL 384

  Fly   377 GINEVGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNN 441
            |..:.|.::.:......||:.|.|||...|.|:| |.||||:.|:|.:|::::..|..::.|:..
plant   385 GPKQTGELWLKGPSIMKGYFSNEEATSSTLDSEG-WLRTGDLCYIDEDGFIFVVDRLKELIKYKG 448

  Fly   442 FQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSG 506
            :|:.|.::|..:|..|.:::|.|...||..........|||   ..|..|:...|...|...::.
plant   449 YQVAPAELEALLLTHPEITDAAVIPFPDKEVGQFPMAYVVR---KTGSSLSEKTIMEFVAKQVAP 510

  Fly   507 AYHIRGGVYFIDSLPKTPNDKLQRRKVL 534
            ...|| .|.|:.|:||.|:.|:.|:.::
plant   511 YKRIR-KVAFVSSIPKNPSGKILRKDLI 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 134/527 (25%)
AFD_class_I 38..529 CDD:302604 131/507 (26%)
OPCL1NP_564115.1 PLN02574 6..546 CDD:215312 139/549 (25%)
4CL 26..536 CDD:213272 134/526 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.