DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and AT1G20500

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_173474.5 Gene:AT1G20500 AraportID:AT1G20500 Length:550 Species:Arabidopsis thaliana

Alignment Length:515 Identity:131/516 (25%)
Similarity:233/516 (45%) Gaps:58/516 (11%)


  Fly    51 TGQELTGAQLAQQSARIAQA-FKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFT 114
            |||.||.:.|.:...|:|.. :..:|:||||||.|.:.||.::..|.::.:..|......:...|
plant    60 TGQCLTFSDLWRAVDRVADCLYHEVGIRRGDVVLILSPNSIFIPVVCLSVMSLGAVFTTANTLNT 124

  Fly   115 EETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNG----------KLEGVLDISEM 169
            ...:......:.|.::|       ..:.:..||.....:.|.:.          ::.|:|  |||
plant   125 SGEISKQIADSNPTLVF-------TTRQLAPKLPVAISVVLTDDEVYQELTSAIRVVGIL--SEM 180

  Fly   170 LNDEDSITAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCNCKN--PNTYTRDSVLL 232
            :..|.|.....    .:::.|.||.::.||||||..|||..|||:|..:...  .:...||.:.:
plant   181 VKKEPSGQRVR----DRVNQDDTAMMLYSSGTTGPSKGVISSHRNLTAHVARFISDNLKRDDIFI 241

  Fly   233 SFSPLYWISGTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDV 297
            ...|::...|.:......:.....::..|.:.:..::..|.:|:.|.|.||. .:.:...:|:|:
plant   242 CTVPMFHTYGLLTFAMGTVALGSTVVILRRFQLHDMMDAVEKHRATALALAP-PVLVAMINDADL 305

  Fly   298 MELKAQLQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLSKNVGGP--------- 353
            ::.|..|.|::.:...|:.:.|.|.....|.......:.||.|:|..|     ||.         
plant   306 IKAKYDLSSLKTVRCGGAPLSKEVTEGFLEKYPTVDILQGYALTESNG-----GGAFTNSAEESR 365

  Fly   354 -VGCEGKVMRNVELRVLDKLKMP-----LGINEVGIIYARLRFKWAGYYRNPEATRRALSSDGMW 412
             .|..|.:..:||.|::|    |     :|||:.|.::.:......||::|.|||...::.:| |
plant   366 RYGTAGTLTSDVEARIVD----PNTGRFMGINQTGELWLKGPSISKGYFKNQEATNETINLEG-W 425

  Fly   413 FRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTA 477
            .:|||:.|:|.:|:|::..|..::.|:..:|:.|.::|..::..|.:.:|.|...||..:.....
plant   426 LKTGDLCYIDEDGFLFVVDRLKELIKYKGYQVPPAELEALLITHPDILDAAVIPFPDKEAGQYPM 490

  Fly   478 CAVVRT-KSPEGERLTADHIRNIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRRKVLGL 536
            ..|||. :|...|:...|.|...|     ..|.....|.||:|:|||.:.|..|:.::.|
plant   491 AYVVRKHESNLSEKQVIDFISKQV-----APYKKIRKVSFINSIPKTASGKTLRKDLIKL 545

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 131/516 (25%)
AFD_class_I 38..529 CDD:302604 129/507 (25%)
AT1G20500NP_173474.5 PLN02574 16..542 CDD:215312 130/511 (25%)
4CL 32..542 CDD:213272 130/511 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.