DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and AT4G19010

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_193636.1 Gene:AT4G19010 AraportID:AT4G19010 Length:566 Species:Arabidopsis thaliana

Alignment Length:533 Identity:123/534 (23%)
Similarity:225/534 (42%) Gaps:100/534 (19%)


  Fly    55 LTGAQLAQQSARI------AQAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEF 113
            |||..::....:|      |..:..||:|:||||.:...||.|...:.::.:..|..:..::|..
plant    68 LTGFSISHTELQIMVQSMAAGIYHVLGVRQGDVVSLVLPNSVYFPMIFLSLISLGAIVTTMNPSS 132

  Fly   114 TEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLNDEDSI-- 176
            :...:|.........:.|...||...:.::.                ..|:.:||.. |.|||  
plant   133 SLGEIKKQVSECSVGLAFTSTENVEKLSSLG----------------VSVISVSESY-DFDSIRI 180

  Fly   177 ----------TAAAYVPCPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCNCK-----NPNTYT 226
                      .:..:||.|.:..|..|.|:.||||||..|||..:||:|:.:.:     ..:.|.
plant   181 ENPKFYSIMKESFGFVPKPLIKQDDVAAIMYSSGTTGASKGVLLTHRNLIASMELFVRFEASQYE 245

  Fly   227 ---RDSVLLSFSPLYWISGTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIA 288
               ..:|.|:..||..|.|..:.:..||:....|:..:.:....::.::.|.|:|...:....:.
plant   246 YPGSSNVYLAALPLCHIYGLSLFVMGLLSLGSTIVVMKRFDASDVVNVIERFKITHFPVVPPMLM 310

  Fly   289 LLSKHDSDVMELKAQ------LQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLS 347
            .|:|        ||:      .:|::.:....:.:.:.......:.:.:...:.|||::|     
plant   311 ALTK--------KAKGVCGEVFKSLKQVSSGAAPLSRKFIEDFLQTLPHVDLIQGYGMTE----- 362

  Fly   348 KNVGGPVGCEG----KVMR---------NVELRVLDKLK---MPLG------INEVGIIYARLRF 390
               ...||..|    |:.|         |::.:|:|...   :|.|      |...|::      
plant   363 ---STAVGTRGFNSEKLSRYSSVGLLAPNMQAKVVDWSSGSFLPPGNRGELWIQGPGVM------ 418

  Fly   391 KWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILR 455
              .||..||:||:.::..|. |.|||||.|.|.:|||:|..|..::.|:..|||.|..:|..::.
plant   419 --KGYLNNPKATQMSIVEDS-WLRTGDIAYFDEDGYLFIVDRIKEIIKYKGFQIAPADLEAVLVS 480

  Fly   456 LPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSGAYHIRGGVYFIDSL 520
            .|.:.:|.|...|:.....:....|||.:.   ..|:.:.:.:.|...::....:| .|..::|:
plant   481 HPLIIDAAVTAAPNEECGEIPVAFVVRRQE---TTLSEEDVISYVASQVAPYRKVR-KVVMVNSI 541

  Fly   521 PKTPNDKLQRRKV 533
            ||:|..|:.|:::
plant   542 PKSPTGKILRKEL 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 123/534 (23%)
AFD_class_I 38..529 CDD:302604 122/528 (23%)
AT4G19010NP_193636.1 PLN02574 9..566 CDD:215312 123/534 (23%)
4CL 41..554 CDD:213272 123/532 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.