DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and 4CL2

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_188761.1 Gene:4CL2 AraportID:AT3G21240 Length:556 Species:Arabidopsis thaliana

Alignment Length:547 Identity:151/548 (28%)
Similarity:250/548 (46%) Gaps:55/548 (10%)


  Fly    15 FGPRGKDFYGP-EMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFKRLGLRR 78
            |..|..|.|.| .:.|.:.|...:...|.:...|...||:..|.|.:...|.::|.....||:::
plant    23 FRSRLPDIYIPNHLPLHDYIFENISEFAAKPCLINGPTGEVYTYADVHVTSRKLAAGLHNLGVKQ 87

  Fly    79 GDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVENYHIIKTV 143
            .|||.|...||..:....:||...|......:|.||...:......:..|:|.  .::.::.|..
plant    88 HDVVMILLPNSPEVVLTFLAASFIGAITTSANPFFTPAEISKQAKASAAKLIV--TQSRYVDKIK 150

  Fly   144 NGKLQNPAKIYLVNGK---LEGVLDISEMLNDE----DSITAAAYVPCPKLHGDHTAFIVCSSGT 201
            |  |||...:.:....   .|..|..||:...|    |||.       .|:..:....:..||||
plant   151 N--LQNDGVLIVTTDSDAIPENCLRFSELTQSEEPRVDSIP-------EKISPEDVVALPFSSGT 206

  Fly   202 TGMPKGVTRSHRSLLCNC------KNPNTY-TRDSVLLSFSPLYWISG-TIILLASLLNGCRRII 258
            ||:||||..:|:.|:.:.      :|||.| .||.|:|...|::.|.. ..|:|.||..|...:|
plant   207 TGLPKGVMLTHKGLVTSVAQQVDGENPNLYFNRDDVILCVLPMFHIYALNSIMLCSLRVGATILI 271

  Fly   259 TNRPYSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIRVLIGAGSKVCKAVCR 323
            ..: :.:..||:.:.|.|||...:....:..::|  |...| |..|.|:|::....:.:.|.:..
plant   272 MPK-FEITLLLEQIQRCKVTVAMVVPPIVLAIAK--SPETE-KYDLSSVRMVKSGAAPLGKELED 332

  Fly   324 RMYELIGNQRFVVGYGLSEMGG-LSKNVG-----GPV--GCEGKVMRNVELRVLDKLKMP----- 375
            .:.....|.:...|||::|.|. |:.::|     .||  |..|.|:||.|:::||    |     
plant   333 AISAKFPNAKLGQGYGMTEAGPVLAMSLGFAKEPFPVKSGACGTVVRNAEMKILD----PDTGDS 393

  Fly   376 LGINEVGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFN 440
            |..|:.|.|..|......||..:|.||...:..|| |..|||:|::|.:..|:|..|..::.|:.
plant   394 LPRNKPGEICIRGNQIMKGYLNDPLATASTIDKDG-WLHTGDVGFIDDDDELFIVDRLKELIKYK 457

  Fly   441 NFQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLS 505
            .||:.|.::|..::..|.:::..|..:.:..:..:....|||:|.   ..::.|.|:..|...: 
plant   458 GFQVAPAELESLLIGHPEINDVAVVAMKEEDAGEVPVAFVVRSKD---SNISEDEIKQFVSKQV- 518

  Fly   506 GAYHIR-GGVYFIDSLPKTPNDKLQRR 531
             .::.| ..|:|.||:||.|:.|:.|:
plant   519 -VFYKRINKVFFTDSIPKAPSGKILRK 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 147/538 (27%)
AFD_class_I 38..529 CDD:302604 143/520 (28%)
4CL2NP_188761.1 PLN02246 14..553 CDD:215137 151/548 (28%)
4CL 32..546 CDD:213272 147/539 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.