DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and Acsf3

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_001079424.4 Gene:Acsf3 RGDID:1586037 Length:583 Species:Rattus norvegicus

Alignment Length:566 Identity:121/567 (21%)
Similarity:224/567 (40%) Gaps:106/567 (19%)


  Fly    32 VIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFKRL-GLRRGD-----VVGISANNST 90
            |.:|.|.. .|:|..| |..|:. |..:|..:|..:||....| |.:.||     |..:.:|:.:
  Rat    46 VFIRALAF-GDRVALI-DKHGRH-TYRELYDRSLCLAQEICSLRGCKVGDLQEERVSFLCSNDVS 107

  Fly    91 YLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYL 155
            |:.:...:.:..|:.: ||:.:..|..::|....:...|:....|....:..:..:|..|..   
  Rat   108 YVIAQWASWMSGGVAV-PLYRKHPEAQLEYFIQDSRSSVVVVGQEYLERLSPLAQRLGVPLL--- 168

  Fly   156 VNGKLEGVLDISEMLNDEDSITAAAYVPCPKLHG----------------DHTAFIVCSSGTTGM 204
                               .:|.|.|      ||                |..|.|..:|||||.
  Rat   169 -------------------PLTPAVY------HGAAEKPIEQPIQEREWRDRGAMIFYTSGTTGR 208

  Fly   205 PKGVTRSHRSL---LCNCKNPNTYTRDSVLLSFSPLYWISGTI-ILLASLLNGCRRIITNRPYSV 265
            |||...:||:|   :....:...:|::.|:|...||:.:.|.: .||..|..|...::... :|.
  Rat   209 PKGALSTHRNLAAVVTGLVHSWAWTKNDVILHVLPLHHVHGVVNKLLCPLWVGATCVMLPE-FSA 272

  Fly   266 EYLLQ--LVARHKVTFLFLASHQI--ALLSKHDSDVMELKAQ-------LQSIRVLIGAGSKVCK 319
            :.:.:  |.:......:|:|...|  .||..:|....:...|       .:.||::: :||....
  Rat   273 QQVWEKFLSSEAPQINMFMAVPTIYSKLLDYYDRHFTQSHVQDFVRAVCKERIRLMV-SGSAALP 336

  Fly   320 AVCRRMYELIGNQRFVVGYGLSEMGGLSKN------VGGPVGCEGKVMRNVELRVLDK------- 371
            ......::.......:..||::|:|....|      |.|.||..   :..||:|::.:       
  Rat   337 VPLLEKWKSATGHTLLERYGMTEIGMALSNPLTEARVPGSVGTP---LPGVEVRIVSENPQKGSS 398

  Fly   372 -----------LKMPLGINE-VGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSE 424
                       .|:..|..| .|.:..:....:..|:..||.|:.|.:.|| ||||||......:
  Rat   399 YTIHAEGNMRGTKVTPGFEEKEGELLVKGPSVFQEYWDKPEETKSAFTPDG-WFRTGDTAVFKDD 462

  Fly   425 GYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAV-STNLTACAVVRTKSPEG 488
            .|........|:.|...:::...:||..:|..|.:::..|.|:||.. ...:||...::    ||
  Rat   463 RYWIRGRTSVDIIKTGGYKVSALEIERHLLAHPSITDVAVIGVPDMTWGQRVTAVVALQ----EG 523

  Fly   489 ERLTADHIRNIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRRKVL 534
            ..|:...::......|: .|.:...:..::::|:....|:.::::|
  Rat   524 HSLSHRDLKEWARGVLA-PYAVPSELLLVEAIPRNQMGKVNKKQLL 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 121/567 (21%)
AFD_class_I 38..529 CDD:302604 117/554 (21%)
Acsf3XP_001079424.4 CaiC 49..572 CDD:223395 120/564 (21%)
MCS 55..564 CDD:213307 117/551 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.