DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and CG6178

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_651221.1 Gene:CG6178 FlyBaseID:FBgn0039156 Length:544 Species:Drosophila melanogaster

Alignment Length:553 Identity:150/554 (27%)
Similarity:263/554 (47%) Gaps:45/554 (8%)


  Fly    19 GKDFYGPEMT---------LGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFKRL 74
            |...||..:|         ||:.|:...:...|:.:.:....|.|.:.:.:.:...|:|...::|
  Fly     8 GNIVYGGPVTERQAQDSRSLGQYILDKYKSFGDRTVLVDAVNGVEYSASFMHKSIVRLAYILQKL 72

  Fly    75 GLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVENYHI 139
            |:::.||||:|:.||......:.|.|..|..:.||:..:::..|.:..::::||:||........
  Fly    73 GVKQNDVVGLSSENSVNFALAMFAGLAVGATVAPLNVTYSDREVDHAINLSKPKIIFASKITIDR 137

  Fly   140 IKTVNGKLQNPAKIYLVNG---KLEGVLDISEMLNDEDSITAAAYVPCPKLHGDHTAFIVCSSGT 201
            :..|..|.:....|..::|   |.:.:.|:.|::.||...|...:........:..:.|||||||
  Fly   138 VAKVASKNKFVKGIIALSGTSKKFKNIYDLKELMEDEKFKTQPDFTSPAANKDEDVSLIVCSSGT 202

  Fly   202 TGMPKGVTRSHRSLLCNCKN---PNTYTRDSV-LLSFSPLYWISGTIILLASLLNGCRRIITNRP 262
            ||:||||..:..:||....:   |.....:.| ||:..|.:...|.:.|:.:...|.|.:...: 
  Fly   203 TGLPKGVQLTQMNLLATLDSQIQPTVIPMEEVTLLTVIPWFHAFGCLTLITTACVGARLVYLPK- 266

  Fly   263 YSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIRVLIGAGSKVCKAVCRRMYE 327
            :..:..|..:.:::|...|:....:..|:||  .::: |..|.|:.||:...:.:.:....::.|
  Fly   267 FEEKLFLSAIEKYRVMMAFMVPPLMVFLAKH--PIVD-KYDLSSLMVLLCGAAPLSRETEDQIKE 328

  Fly   328 LIGNQRFVVGYGLSEMGGLSKNVGGPVGCE----GKVMRNVELRVLD----KLKMPLGINEVGII 384
            .||......|||||| ..||..|.....|:    |.:...:..:|:|    ||   ||.||.|  
  Fly   329 RIGVPFIRQGYGLSE-STLSVLVQNDEFCKPGSVGVLKVGIYAKVIDPDTGKL---LGANERG-- 387

  Fly   385 YARLRFK----WAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIY 445
              .|.||    ..||..:.::|:.|: .|| |..||||||.|.:...:|..|..::.|:..:|:.
  Fly   388 --ELCFKGDGIMKGYIGDTKSTQTAI-KDG-WLHTGDIGYYDDDFEFFIVDRIKELIKYKGYQVP 448

  Fly   446 PEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSGAYHI 510
            |.:||..:|....:.:|.|.|.||..:..|....||:..:.:   ||.:.:...|..:.|.|..:
  Fly   449 PAEIEALLLTNDKIKDAAVIGKPDEEAGELPLAFVVKQANVQ---LTENEVIQFVNDNASPAKRL 510

  Fly   511 RGGVYFIDSLPKTPNDKLQRRKVLGLVQQLELK 543
            ||||.|:|.:||.|:.|:.||.:..::::.:.|
  Fly   511 RGGVIFVDEIPKNPSGKILRRILREMLKKQKSK 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 147/548 (27%)
AFD_class_I 38..529 CDD:302604 140/510 (27%)
CG6178NP_651221.1 PLN02246 26..537 CDD:215137 145/528 (27%)
Firefly_Luc_like 43..529 CDD:213279 139/503 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333840at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.