DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and CG11453

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_650832.1 Gene:CG11453 FlyBaseID:FBgn0038734 Length:539 Species:Drosophila melanogaster

Alignment Length:541 Identity:195/542 (36%)
Similarity:298/542 (55%) Gaps:41/542 (8%)


  Fly     7 YDAASRTWFGPRGKDFYGPEMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAF 71
            :|..::.|.|||...|:..:.::|:::...::.:.:.:.||.||.|..||..:....:.||||..
  Fly     8 FDKYTKIWSGPRPASFFDADCSIGKILFAFMRNHPNSICQISDTEGTALTNGEAITFAIRIAQQL 72

  Fly    72 KRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVEN 136
            |.:||::.|||||...|:|||..|::..||.|.|.:.:.|...|:|:|:::.||.||:||||.:.
  Fly    73 KAMGLKQDDVVGIVGTNTTYLMPVVLGCLLNGTPFHAVSPWQDEDTIKHLFSITRPKLIFCDGKC 137

  Fly   137 YHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLNDEDSITAAAYVP-CPKLHGDHTAFIVCSSG 200
            :..:..:...|:  :.:|.:.....|:..:.::|  |.:.....||| ...|.||||..|:|:||
  Fly   138 FQRLSIIARILK--SHVYTLKDHRLGMPRVEDLL--EPTTAELYYVPETLLLGGDHTVAILCTSG 198

  Fly   201 TTGMPKGVTRSHRSLLCNCKNPNTYTRDSVLLSFSPLYWISGTIILLASLLNGCRRIITNRPYSV 265
            |||:||.|..|:.:.|.:.   ...|...||||||.:.|.:|...:|.|..:|..||||:|||:.
  Fly   199 TTGLPKAVCISNSACLFDF---GFVTGQDVLLSFSTIDWSAGMFNMLFSCCHGSTRIITDRPYTP 260

  Fly   266 EYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIR-VLIGAGSKVCKAVCRRMYELI 329
            ||::|||.::|||.|.:...|:|.|.|  :..:. |.:|.||| |.:|.||  |...     .|:
  Fly   261 EYMIQLVEKYKVTLLTVVPQQVASLLK--TPTLN-KQRLASIRFVSVGGGS--CYVA-----NLL 315

  Fly   330 GNQRFVV------GYGLSEMGGLSKNVG-GPVGCEGKVMRNVELRVLDKLKMPLGINEVGIIYAR 387
            ..|.|::      ||.|:|.||::.|:| ......|:::..|.:::||:....||..|.|.|...
  Fly   316 KLQEFLITGQISYGYALTECGGVAANMGVAKPSSVGRIVPGVRVKILDEAGRSLGHGETGEILVH 380

  Fly   388 LRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEF 452
            ....|.|||.||..::|.....| ||.|||:||.|:|.||:|..|..|:.:|:..|..|::||:.
  Fly   381 NGKVWNGYYANPNESKRMQDYQG-WFHTGDMGYFDNENYLHIVERKEDLLRFHGAQYSPQEIEQV 444

  Fly   453 ILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHI------RNIVEHHLSGAYHIR 511
            |..||.|.||||||:.:.|..:..|.|||  |.| |.|||...|      |.:|:|.     .:.
  Fly   445 IAELPDVIEACVFGLWNEVDGDPAAAAVV--KIP-GSRLTEMDIVEYVAKRLVVDHK-----QLH 501

  Fly   512 GGVYFIDSLPKTPNDKLQRRK 532
            .||:|:..||||.:.|:.|::
  Fly   502 CGVFFLPELPKTGSGKVLRQQ 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 189/524 (36%)
AFD_class_I 38..529 CDD:302604 187/506 (37%)
CG11453NP_650832.1 CaiC 18..530 CDD:223395 192/532 (36%)
Firefly_Luc_like 46..519 CDD:213279 187/499 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773444
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.861654 Normalized mean entropy S3159
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.