DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and CG6300

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_650828.1 Gene:CG6300 FlyBaseID:FBgn0038730 Length:537 Species:Drosophila melanogaster

Alignment Length:544 Identity:153/545 (28%)
Similarity:259/545 (48%) Gaps:43/545 (8%)


  Fly     4 EVHYDAASRTWFGPRGKDFYGPEMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIA 68
            |..||...:.|.|.....::.|::::||:|...::.:.....||..|.|..||..:|...:.|:|
  Fly     6 ENSYDNDQKIWSGEPVVKYFDPDLSIGEIIFHEMRRHPQLTAQISATEGTVLTRGELLANAMRLA 70

  Fly    69 QAFKRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCD 133
            ...:.|||.:.|:|||...|:|::.:|..|....||..:.|:..:..:|::.:|.:|.|.:||||
  Fly    71 SYMRSLGLLQSDIVGIIGRNTTHMLAVAYACFFNGIAFHSLNITYDRDTIEKIYKVTRPSIIFCD 135

  Fly   134 VENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLNDE-DSITAAAYVPCP--------KLH- 188
            .:.:..:::...:|.               :.|..|.|.. |||.....|..|        ||. 
  Fly   136 GDEFEKVRSATAELD---------------VKIVTMRNHPLDSIKIDEVVATPIEENFQPAKLEK 185

  Fly   189 -GDHTAFIVCSSGTTGMPKGVT-RSHRSLLCNCKNPNTYTRDSVLLSFSPLYWISGTIILLASLL 251
             .|.|..|:|||||||.||.|| .:.|.:|..  |.:..|.| |..|.:.|.||:|.:..:.|.:
  Fly   186 GNDQTLAILCSSGTTGTPKAVTITNSRHILAG--NYHLTTAD-VQYSHNTLDWITGLLTTITSGV 247

  Fly   252 NGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIAL-LSKHDSDVMELKAQLQSIRVLIGAGS 315
            ....|||.:..:...:.|:::..:|||:.......:|| ::..|.:..:    :.|:|..:..||
  Fly   248 FSTTRIIADNAFDPAFALRIIEEYKVTWTIQPPSSMALMINCPDFETCD----MSSLRCYMFGGS 308

  Fly   316 KVCKAVCRRMYELIGNQRFVVGYGLSEMGGLSK---NVGGPVGCEGKVMRNVELRVLDKLKMPLG 377
            :....|.:.:...:.:......||.:|:|.::.   :.....|..|:::..:::::::.....||
  Fly   309 RAALEVQKGIRSRLSHDCLQFVYGFTELGAMATINCHFDEKTGSVGQLVNGLKMKIINDDGESLG 373

  Fly   378 INEVGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNF 442
            .:|:|.:.......|:|||.|...||....|.| |:.:||:||:|.:|:|||..|..::.|:.|.
  Fly   374 PDEIGEVCIMNNQHWSGYYGNEVETRNMRDSLG-WYHSGDLGYMDRDGFLYIMDRKKEMLKYQNI 437

  Fly   443 QIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSGA 507
            ..||..||..|..:|.|:|.|||||...:..:..|.|||:..   |..|.|..:.:.|.......
  Fly   438 MYYPNDIESVISEMPQVAEVCVFGIWSNIFGDEAAAAVVKKL---GSELEAQDVVDYVRSRTDSK 499

  Fly   508 Y-HIRGGVYFIDSLPKTPNDKLQR 530
            | .:.||...:|.|.::.|.|..|
  Fly   500 YKQLNGGAVIVDDLQRSANGKTNR 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 148/524 (28%)
AFD_class_I 38..529 CDD:302604 143/508 (28%)
CG6300NP_650828.1 CaiC 26..523 CDD:223395 147/523 (28%)
AFD_class_I 47..522 CDD:302604 143/501 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773873
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.