DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and CG18586

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_647993.2 Gene:CG18586 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster

Alignment Length:535 Identity:152/536 (28%)
Similarity:263/536 (49%) Gaps:25/536 (5%)


  Fly     7 YDAASRTWFGPRGKDFYGPEMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAF 71
            ||...:.|.|......:.|.:::||:|...:..|...:.||..|....||...|...:.|:|...
  Fly    17 YDDKLKIWSGREAPSLFSPNLSIGEIIFGDMVNNPKLIAQISITEDIVLTREDLHMNAMRVASYM 81

  Fly    72 KRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVEN 136
            :.:||.:.|:||:...::|:.::|..|....|.|::.||..:.|..:..::.||:|::||||.:.
  Fly    82 RNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGTPLHALHNAYEEACIAKLFGITKPRLIFCDGDE 146

  Fly   137 YHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLNDEDSITAAAYVPCPKLHG-DHTAFIVCSSG 200
            |..:|:....||  ..|..:.....|.:.|.::|.   :.....:.|.....| |||..|:.|||
  Fly   147 YEKVKSATKDLQ--VTIVTMRNHPRGSVRIQDVLT---TPVMQNFQPLRLKDGIDHTLAILSSSG 206

  Fly   201 TTGMPKGVT--RSHRSLLCNCKNPNTYTRDSVLLSFSPLYWISGTIILLASLLNGCRRIITNRPY 263
            |:|.||.||  .||:.::    :.......::..:.|.|.|.||..:.:.|.:.....||.:..:
  Fly   207 TSGFPKAVTISNSHKIIV----DYMAINNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIADCDF 267

  Fly   264 SVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELK-AQLQSIRVLIGAGSKVCKAVCRRMYE 327
            ......:.:.:::::.:.|:|..:|:.    ::..|.: |.|.|:..:|..||.....|.|::..
  Fly   268 DPGLFCRAIGKYRISMVLLSSSYLAIF----ANCPEFESADLSSLNYVIFGGSSCSLEVQRKVRS 328

  Fly   328 LIGNQRFVVGYGLSEM---GGLSKNVGGPVGCEGKVMRNVELRVLDKLKMPLGINEVGIIYARLR 389
            .:.:......|||:|:   |.::.|........|:.:|.::::|:|:.......|.||.|.....
  Fly   329 RLSHDCLNFCYGLTELNSAGSVNLNFDEKPNSVGRAIRGIKIKVIDEQGEAQEPNVVGEICFHNS 393

  Fly   390 FKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFIL 454
            .||||||:||:.||:...|:. |..|||:||:|.:|||::..|..|:.|:.|...||.:||..|.
  Fly   394 QKWAGYYKNPDETRQIQDSEN-WIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIA 457

  Fly   455 RLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSGAY-HIRGGVYFID 518
            .:|.|.|||||||.|.|:.:..|.::|  |.| |.:|.|..:...|...::..: .:.||...:|
  Fly   458 EMPNVLEACVFGIWDPVNGDEAAASLV--KKP-GTQLEAQDVVEYVRKRITAKFKQLNGGALIVD 519

  Fly   519 SLPKTPNDKLQRRKV 533
            .:.::.|.|..|..|
  Fly   520 QIVRSGNRKTNRSAV 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 148/518 (29%)
AFD_class_I 38..529 CDD:302604 142/499 (28%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 148/518 (29%)
AFD_class_I 55..530 CDD:302604 141/492 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130773760
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.