DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and CG9993

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_611518.1 Gene:CG9993 FlyBaseID:FBgn0034553 Length:543 Species:Drosophila melanogaster

Alignment Length:531 Identity:297/532 (56%)
Similarity:386/532 (73%) Gaps:8/532 (2%)


  Fly     7 YDAASRTWFGPRGKDFYGPEMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAF 71
            ||:..:.|.||:.|::|||:||||||.:.:|::.:|:|||:.|.||:||||:||.:||.|:|.||
  Fly     6 YDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPTGEELTGSQLLEQSRRLAHAF 70

  Fly    72 KRLGLRRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVEN 136
            :||.|:|||||||||.|:||||.|:|||||.|.|||||||:|..||..||::||:|||||||::|
  Fly    71 QRLKLQRGDVVGISAKNTTYLTEVVIAALLNGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDN 135

  Fly   137 YHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEMLND----EDSITAAAYVPCPKLHGDHTAFIVC 197
            |..:..|...|:...:|.|:.|.|.||.:|.::|.|    .|..|..|   ||.|.||.||||:.
  Fly   136 YQTLSAVKSSLKFKTEIILLTGTLPGVRNIQDLLADGCTGYDEKTLFA---CPHLCGDDTAFIIT 197

  Fly   198 SSGTTGMPKGVTRSHRSLLCNCKNPNTYTRDSVLLSFSPLYWISGTIILLASLLNGCRRIITNRP 262
            |||.||:||||||||||||.:.|.|..:|.|:||..||||||||....|||||:|||||||||||
  Fly   198 SSGVTGLPKGVTRSHRSLLNSAKIPQLFTSDTVLFCFSPLYWISCIFTLLASLVNGCRRIITNRP 262

  Fly   263 YSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIRVLIGAGSKVCKAVCRRMYE 327
            :||.|...||.||:|:|:....|.:|||:| ..:..||.|::|.::..:.:||||...:.|::||
  Fly   263 FSVAYFADLVERHQVSFVLTVPHHMALLAK-SPERQELAAKMQCVQSFVCSGSKVPMGIWRQLYE 326

  Fly   328 LIGNQRFVVGYGLSEMGGLSKNVGGPVGCEGKVMRNVELRVLDKLKMPLGINEVGIIYARLRFKW 392
            |:|..||.|.|||:|.||:|||||||:|.||:::|||::||:|.....||.|:.|.|..||..:|
  Fly   327 LLGANRFAVLYGLTETGGISKNVGGPLGSEGRLLRNVQVRVVDPHGQSLGPNQTGQILVRLNLRW 391

  Fly   393 AGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLP 457
            .|||.||:.|:..::.||.|..|||.||.|.||.|:.|:|||||||:|:|.|||:|||:.||.||
  Fly   392 GGYYHNPQETQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIEDVILHLP 456

  Fly   458 GVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSGAYHIRGGVYFIDSLPK 522
            ||.|..||||||.||||||||||||.:...|.:||...::.:|..|||.|:||||||:|:|:|||
  Fly   457 GVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVAQHLSDAFHIRGGVFFVDNLPK 521

  Fly   523 TPNDKLQRRKV 533
            |.|.|:||||:
  Fly   522 TQNSKVQRRKI 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 289/514 (56%)
AFD_class_I 38..529 CDD:302604 277/495 (56%)
CG9993NP_611518.1 CaiC 21..532 CDD:223395 291/515 (57%)
AFD_class_I 45..528 CDD:302604 274/487 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130771737
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333840at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.