DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and CG12512

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_608924.1 Gene:CG12512 FlyBaseID:FBgn0031703 Length:593 Species:Drosophila melanogaster

Alignment Length:584 Identity:134/585 (23%)
Similarity:250/585 (43%) Gaps:88/585 (15%)


  Fly    20 KDFYGPEMTLGEVIMRVLQINAD-----QVMQICDTTGQELTGAQLAQQSARIAQAFKRLGLRRG 79
            |...|.:..:...|.:.|:::|.     :.:..|. .|:..:...|.|::..:|..|::|||:.|
  Fly    36 KHHIGKDPLVYRTIGQQLELSASNFGDVEAIVSCH-EGKRYSFKSLLQEADALAAGFRKLGLQPG 99

  Fly    80 DVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFC----DVENYH-I 139
            |.||:.|.|..:....::.|...|:....|:|.:....:.|..:....|.|..    ..:||: |
  Fly   100 DAVGLWAPNYLHWYLGMMGAARAGLTSVGLNPAYQGPEIAYCLNKVNVKAIIAPETFKTQNYYEI 164

  Fly   140 IKTV--------NGKLQNPAKIYL------VNGKLEGVLDISEMLN-------DEDSITAAAYVP 183
            ::.:        .||:::....:|      .|..|:|.|...:.|:       :|.:....:.:|
  Fly   165 LRDICPEISDADTGKIRSEKFPHLRSVIIDSNDSLKGALRFDDFLDLASKSEREEVAKMQKSILP 229

  Fly   184 CPKLHGDHTAFIVCSSGTTGMPKGVTRSHRSLLCN---CKNPNTYTRDSVLLSFSPLYWISGTII 245
                  :....|..:|||||.||....:|.:.:.|   ..|.|....:.:.:.. |::...|.||
  Fly   230 ------ESACNIQFTSGTTGNPKAACLTHHNFVNNGIHVGNRNELEGERICVQV-PMFHAFGVII 287

  Fly   246 -LLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVM---------EL 300
             ::|:|..|...::....:|.:..||.:...|.:.:            |.:..|         :|
  Fly   288 SIMAALTKGATMVLPAAGFSPKDSLQAIVNEKCSVI------------HGTPTMYVDLVNTQKKL 340

  Fly   301 KAQLQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSE--------MGGLSKNVGGPVGCE 357
            :..|..|:..:..|:.|...:.:.:.:::..:.....|||:|        :.|.|.:|  .:...
  Fly   341 QVPLGRIKKAVTGGAIVSPQLIKDVRQVLNVEAVHSVYGLTETTAVIFQSLPGDSSDV--VLNSV 403

  Fly   358 GKVMRNVELRVLDKLKMPLGINEVGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLD 422
            |.:..::|.:|:|.....:...:.|.:..|......||:.:.|.|:..:.:| .|.||||...|:
  Fly   404 GHLTDHIEAKVVDAEGRCVPFGQPGELCVRGYTTMLGYHDDEEKTKETIGND-RWLRTGDQFVLE 467

  Fly   423 SEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPE 487
            :.||..|..|..::.......|:|::||:|:...|.|.||.|.|:||. ......||.||.:  |
  Fly   468 ANGYGRIVGRLKEMLIRGGENIFPKEIEDFLNAHPQVIEAHVIGVPDE-RLGEEVCAYVRLE--E 529

  Fly   488 G---ERLTADHIRNIVEHHLSGAYHIRGGVYF--IDSLPKTPNDKLQRRKVLGL--VQQLELKA 544
            |   ...||:.::...:..|:   |.:...|.  ||:.|||.:.|:|:.|::..  .::.||||
  Fly   530 GVDPASFTAETLKAYAKGKLA---HFKVPRYVIPIDAFPKTTSGKIQKFKLVEAFKAKETELKA 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 132/580 (23%)
AFD_class_I 38..529 CDD:302604 124/548 (23%)
CG12512NP_608924.1 PRK08315 43..592 CDD:236236 132/578 (23%)
FACL_like_2 229..577 CDD:213284 91/376 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.