DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and pdgy

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001188590.1 Gene:pdgy FlyBaseID:FBgn0027601 Length:597 Species:Drosophila melanogaster

Alignment Length:541 Identity:133/542 (25%)
Similarity:228/542 (42%) Gaps:54/542 (10%)


  Fly    25 PEMTLGEVIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFK-RLGLRRGDVVGISANN 88
            |.:.|.|.:.|..:....:...:|..|.::.|.||:...||..|...: :..|::.||:.|...|
  Fly    73 PNVPLHEYVWRDFKKWERRTAAVCVITDRQYTFAQMRDASAAFAVRLQTKFNLQKPDVLAICLPN 137

  Fly    89 STYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKI 153
            ........:.|:..|:.:..::|.:|.:.:......:..|.:...|..:..:...:..:.....|
  Fly   138 LPEYPIATLGAIEAGLTVTTVNPVYTPDEIARQLTFSGAKFLVGTVSGFATLSQASKLVGRQIPI 202

  Fly   154 YLVNGKL-----EGVLDISEMLNDEDSITAAAY--VPCPK-LHGDHTAFIVCSSGTTGMPKGVTR 210
            .:|....     ||.:|.||:.:.::    ..|  :..|| ...|...|:..||||||:||||..
  Fly   203 AVVRTSAEEALPEGAIDFSELTSTQN----VRYEDLKAPKEASADDMVFLPFSSGTTGLPKGVML 263

  Fly   211 SHRSLLCNCK-----------NPNTYTRDSVLLSFSPLYWISG-TIILLASLLNGCRRIITNRPY 263
            ||.::..||:           .|.. |...||    |.:.|.| |:::|:.|..|| |:.|...:
  Fly   264 SHNNITSNCEQVQASLPLDLMGPQN-TLPGVL----PFFHIYGLTVVMLSKLGQGC-RLATMPCF 322

  Fly   264 SVEYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIRVLIGAGSKVCKAVCRRMYEL 328
            ..:..::.:.:::.:.|.|.......:..|.....|....|   :|::...:.:.:....|....
  Fly   323 KPDDFMRSLDKYQGSILNLVPPIALFMINHPKLTQETAPHL---KVVMSGAAPIGQHDVERFLNK 384

  Fly   329 IGNQRFVVGYGLSEMGG--LSKNVGGPV-GCEGKVMRNVELRVLDKLKMPL--------GINEVG 382
            ..|..|..|||::|...  |....|..| ...|.:..:.|.::     :||        |....|
  Fly   385 FPNTVFKQGYGMTEASPVVLLTPEGNKVYASTGVLPASTEAKI-----VPLDGSDAKGVGPRTTG 444

  Fly   383 IIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTRDTDVFKFNNFQIYPE 447
            .:..|.....|||..|.|| .:.....|.|.|:||:.:.|.:|..||..|..::.|...||:.|.
  Fly   445 ELCVRGPQVMAGYLNNDEA-NQVTFYPGNWLRSGDVAFYDEDGLFYITDRMKELIKVKGFQVPPA 508

  Fly   448 QIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLTADHIRNIVEHHLSGAYHIRG 512
            ::|..:...|.:.||.|||||...:.......||..   :||:.:|:.|...|...::....:.|
  Fly   509 ELEAVLRDHPKILEAAVFGIPHEFNGEAPRAIVVLR---QGEKASAEEISAYVAERVAHYKKLEG 570

  Fly   513 GVYFIDSLPKTPNDKLQRRKV 533
            ||.|:|.:||.|..|:.||::
  Fly   571 GVIFVDEVPKNPTGKILRREL 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 133/542 (25%)
AFD_class_I 38..529 CDD:302604 127/523 (24%)
pdgyNP_001188590.1 CaiC 77..595 CDD:223395 132/538 (25%)
Firefly_Luc_like 99..587 CDD:213279 126/510 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90959262
eggNOG 1 0.900 E1_COG0318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333840at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24096
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.