DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and Acsf3

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_659181.2 Gene:Acsf3 MGIID:2182591 Length:583 Species:Mus musculus

Alignment Length:573 Identity:127/574 (22%)
Similarity:219/574 (38%) Gaps:120/574 (21%)


  Fly    32 VIMRVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFKRL-GLRRGD-----VVGISANNST 90
            |.:|.|.. .|::..| |..|.. |..:|..:|..:||...|| |.:.||     |..:.:|:.:
Mouse    46 VFIRALAF-GDRIALI-DKYGHH-TYRELYDRSLCLAQEICRLQGCKVGDLQEERVSFLCSNDVS 107

  Fly    91 YLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYL 155
            |:.:...:.:..|:.: ||:.:..|..::|....:...::....|....:..:..:|..|..   
Mouse   108 YVVAQWASWMSGGVAV-PLYWKHPEAQLEYFIQDSRSSLVVVGQEYLERLSPLAQRLGVPLL--- 168

  Fly   156 VNGKLEGVLDISEMLNDEDSITAAAYVPCPKLHG----------------DHTAFIVCSSGTTGM 204
                               .:|.|.|      ||                |..|.|..:|||||.
Mouse   169 -------------------PLTPAVY------HGATEKPTEQPVEESGWRDRGAMIFYTSGTTGR 208

  Fly   205 PKGVTRSHRSL---LCNCKNPNTYTRDSVLLSFSPLYWISGTI-ILLASLLNGCRRIITNRPYSV 265
            |||...:||:|   :....:...:|::.|:|...||:.:.|.: .||..|..|...::... :|.
Mouse   209 PKGALSTHRNLAAVVTGLVHSWAWTKNDVILHVLPLHHVHGVVNKLLCPLWVGATCVMLPE-FSA 272

  Fly   266 ----EYLLQLVARHKVTFLFLASHQIALLSKHDSDVMELKAQLQSIRVLIGAGSKVCKAVCRRMY 326
                |..|...|.....|:.:.:....||..:|....:...| ..:|.       |||...|.|.
Mouse   273 QQVWEKFLSSEAPQITVFMAVPTVYSKLLDYYDKHFTQPHVQ-DFVRA-------VCKERIRLMV 329

  Fly   327 E--------LIGNQRFVVG------YGLSEMGGLSKN------VGGPVGCEGKVMRNVELRVLDK 371
            .        |:...|...|      ||::|:|....|      |.|.||..   :..||:|::.:
Mouse   330 SGSAALPVPLLEKWRSATGHTLLERYGMTEIGMALSNPLTEARVPGSVGTP---LPGVEVRIISE 391

  Fly   372 ------------------LKMPLGINE-VGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGD 417
                              .|:..|..| .|.:..|....:..|:..||.|:.|.:||| ||||||
Mouse   392 NPQKGSPYIIHAEGNERGTKVTPGFEEKEGELLVRGPSVFREYWDKPEETKSAFTSDG-WFRTGD 455

  Fly   418 IGYLDSEGYLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAV-STNLTACAVV 481
            ........|........|:.|...:::...:||..:|..|.:::..|.|:||.. ...:||...:
Mouse   456 TAVFKDARYWIRGRTSVDIIKTGGYKVSALEIERHLLAHPSITDVAVIGVPDMTWGQRVTAVVAL 520

  Fly   482 RTKSPEGERLTADHIRNIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRRKVL 534
            :    ||..|:...::......|: .|.:...:..::.:|:....|:.::::|
Mouse   521 Q----EGHSLSHGDLKEWARGVLA-PYAVPSELLLVEEIPRNQMGKVNKKELL 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 127/574 (22%)
AFD_class_I 38..529 CDD:302604 123/561 (22%)
Acsf3NP_659181.2 CaiC 49..572 CDD:223395 126/571 (22%)
MCS 55..564 CDD:213307 123/558 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.