DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17999 and ACSF3

DIOPT Version :9

Sequence 1:NP_611517.1 Gene:CG17999 / 37357 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_005256350.1 Gene:ACSF3 / 197322 HGNCID:27288 Length:610 Species:Homo sapiens


Alignment Length:571 Identity:130/571 - (22%)
Similarity:238/571 - (41%) Gaps:100/571 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ICDTTGQELTGAQLAQQSARIAQAFKRL------GLRRGDVVGISANNSTYLTSVIIAALLRGIP 105
            :.|..|:. |..:|..:|.|::|...||      .||...|..:.||:::|:.:...:.:..|:.
Human    59 LVDQHGRH-TYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGGVA 122

  Fly   106 INPLHPEFTEETVKYMYDITEPKVIFCDVENYHIIKTVNGKLQNPAKIYLVNGKLEGVLDISEML 170
            : ||:.:.....::|:...::..|:....|...::..|..||..|            :|.::..:
Human   123 V-PLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVP------------LLPLTPAI 174

  Fly   171 NDEDSITAAAYVPCPKLHG--DHTAFIVCSSGTTGMPKGVTRSH---RSLLCNCKNPNTYTRDSV 230
            . ..::...|.||.|: .|  :..|.|:.:|||||.||||..:|   |:::....:...:|:|.|
Human   175 Y-TGAVEEPAEVPVPE-QGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHKWAWTKDDV 237

  Fly   231 LLSFSPLYWISGTI-ILLASLLNG--CRRIITNRPYSV--EYLLQLVARHKVTFLFLASHQIALL 290
            :|...||:.:.|.: .||..|..|  |..:....|..|  ::|.....|..| |:.:.:....|:
Human   238 ILHVLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLSSETPRINV-FMAVPTIYTKLM 301

  Fly   291 SKHDSDVMELKAQ-------LQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLSK 348
            ..:|....:..||       .:.||:::...:.:...|..:...:.|: ..:..||::|:|   .
Human   302 EYYDRHFTQPHAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGH-TLLERYGMTEIG---M 362

  Fly   349 NVGGPV-------GCEGKVMRNVELRVLDK-------------------LKMPLGINE-VGIIYA 386
            .:.||:       |..|..:..|::|::.:                   .|:..|..| .|.:..
Human   363 ALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEEKEGELLV 427

  Fly   387 RLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYLYIQTR-DTDVFKFNNFQIYPEQIE 450
            |....:..|:..||.|:.|.:.|| ||:|||. .:..:|..:|:.| ..|:.|...:::...::|
Human   428 RGPSVFREYWNKPEETKSAFTLDG-WFKTGDT-VVFKDGQYWIRGRTSVDIIKTGGYKVSALEVE 490

  Fly   451 EFILRLPGVSEACVFGIPDAV-STNLTACAVVR--------------------TKSPEGERLTAD 494
            ..:|..|.:::..|.|:||.. ...:||...:|                    ||..|...|...
Human   491 WHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARLKEHPTKRRENSILNIG 555

  Fly   495 HIRNIVE--HHLSGAYHIRGGVYF--IDSLPKTPNDKLQRRKVLGLVQQLE 541
            ..||:..  ..|:|....|.....  :.|..:|.| .|:|.|:..|.|.|:
Human   556 RKRNLASGMRALTGRMAARRAAVSSEVSSSDETDN-SLKRHKLPRLTQTLK 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 130/571 (23%)
AFD_class_I 38..529 CDD:302604 124/557 (22%)
ACSF3XP_005256350.1 MCS 55..546 CDD:341264 113/509 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.