DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and acs-9

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_510728.2 Gene:acs-9 WormBaseID:WBGene00020634 Length:497 Species:Caenorhabditis elegans

Alignment Length:562 Identity:141/563 (25%)
Similarity:236/563 (42%) Gaps:120/563 (21%)


  Fly    23 YGPEMTLGEVIM-RVLQINADQVMQICDTTGQELTGAQLAQQSARIAQAFKRLGLRRGDVVGISA 86
            |.||....::|: .|::....|.: :.|  .|.:|..::.|..:::......||:.:||.:.:..
 Worm     4 YYPETLFHDLILENVVKFGIRQAL-VHD--NQVITFEEIPQLVSKLVYKLLELGISQGDTILVCL 65

  Fly    87 NNS-----TYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCD----VENYHIIKT 142
            .||     .:|:...|.|:|.||.    | |.|...:||....:..|::|.:    .|||..:..
 Worm    66 PNSIWYPLLFLSCAKIGAVLSGIS----H-ESTAGEIKYSLKQSGAKLVFTNEKVSKENYWALSE 125

  Fly   143 VNGK-LQNPAKIYLVNGKLEGVLDISEMLNDEDSITAAAYVPCPKLHGDHTAFIVCSSGTTGMPK 206
            .:.: |.:..|.|:  .::.|..|......|.|||..|.:                ||||||.||
 Worm   126 NSVEVLPDSVKTYI--DRITGHEDFRPENLDIDSILLAPF----------------SSGTTGAPK 172

  Fly   207 GVTRSHRSLLCNCKNPNTYTRDSVL-------LSFSPLYWISGTIILLASLLNGCRRIITNRPYS 264
            ....:||:.|....:...:..|.:|       |:|.|.:..||...||..||.||          
 Worm   173 CCLLTHRNFLAATYSLKKFLFDQLLAQSSMKTLAFLPFHHASGFWALLICLLEGC---------- 227

  Fly   265 VEYLLQLVARHKVTFLFLASHQIA---LLSKHDSDVME--------------LKAQLQSIRVLIG 312
                        .|::....|.|.   |:.|::.|.:.              |:.:..|:|.::.
 Worm   228 ------------TTYIMSEFHPIVMMDLIEKYEIDTINIVPPIANIFLKMGILQGRCPSLRTILC 280

  Fly   313 AGSKVCKAVCRRMYELIGN-QRFVVGYGLSEMGGLS---------KNVGGPVGCEGKVMRNVELR 367
            ..|.:.|..|:|:..:... ..|:.|||::|:..||         :::|   .| |.::...|.:
 Worm   281 GSSGLQKDRCKRLLSIFPQVTHFIQGYGMTELVVLSCVTPFDDNFEHLG---SC-GHILPGFETK 341

  Fly   368 VLDKLKMPLGINEV-----GIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEGYL 427
            :.:.   |.|..|:     .|:.|         |:|....   |..|. |..|||| ..:..|:.
 Worm   342 LFEH---PTGETELWLKSDAIMKA---------YKNGTPN---LDEDD-WLHTGDI-VTEKGGFF 389

  Fly   428 YIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGERLT 492
            |:..|..|:.|.|.:|:.|.:||..||.||.|:|..|.||.|.:...|....:|..|:.: |.|.
 Worm   390 YVVDRMKDLIKLNGYQVSPTEIENVILTLPKVAEVAVVGIEDELCGQLPKAYIVLEKNAD-ELLF 453

  Fly   493 ADHIRNIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRRKVL 534
            ..|:.:.::..||....:||||..|..:||:.:.|:|:.:::
 Worm   454 LKHLEHTMKEKLSAVKQLRGGVSIIKEMPKSSSGKIQKNRLM 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 140/561 (25%)
AFD_class_I 38..529 CDD:302604 135/540 (25%)
acs-9NP_510728.2 CaiC 1..494 CDD:223395 141/560 (25%)
Firefly_Luc_like 26..490 CDD:213279 134/534 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.