DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17999 and acs-7

Sequence 1:NP_611517.1 Gene:CG17999 FlyBaseID:FBgn0034552 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_495979.1 Gene:acs-7 WormBaseID:WBGene00007228 Length:540 Species:Caenorhabditis elegans

Alignment Length:561 Identity:132/562 (23%)
Similarity:242/562 (43%) Gaps:88/562 (16%)


  Fly    22 FYGPEM-----TLGEVIMRVLQINADQ-----VMQICDTTGQELTGAQLAQQSARIAQAFKRLGL 76
            |:|.::     .:.||::...:::.::     .....:.....|...||.::..:|::.|...|.
 Worm     3 FHGEQLENHDKPVHEVLLERFKVHQEKDPDNVAFVTAENEDDSLGFQQLGKKVLQISEWFVENGY 67

  Fly    77 RRGDVVGISANNSTYLTSVIIAALLRGIPINPLHPEFTEETVKYMYDITEPKVIFCD-------- 133
            ::|||..:::.|:....:..:.|...|:.::....:||...:.|..:.::.:||..|        
 Worm    68 KKGDVFLLASYNNWRCFAAALGAWRAGLIVSAAASQFTSFEMNYQIEDSQSQVILVDKHTLPVVQ 132

  Fly   134 --VENYHIIKTVNGKLQNP----AKIYLVNGKLEGVLDISEMLNDEDSITAAAYVPCPKLHGDHT 192
              .:|...:|.:.....||    .|..::..:|  |.::...|.|            ||   :..
 Worm   133 EACKNLKFVKQIISISANPPSPVIKFDVLTSRL--VRNLKMPLID------------PK---NDI 180

  Fly   193 AFIVCSSGTTGMPKGVTRSH-----------RSLLCNCK----NPNTYTRDSVL---LSFSPLYW 239
            .|:..||||||.||||..||           |....|.|    .|     |.||   |.|.|:|.
 Worm   181 VFLPYSSGTTGKPKGVMISHLNFSMMLESSLRFFDANAKAIGLPP-----DFVLPYDLHFLPMYH 240

  Fly   240 ISGTIILLASLLNGCRRIITNRPYSVEYLLQLVARHKVTFLFLASHQIA-------LLSKHDSDV 297
            ..|....|.:...|..:|:..: :.:|.:|:.:.::.:..|.|.. .||       ||.|:|...
 Worm   241 AMGMFRTLLTSYRGTTQIMFTK-FDMELMLKNIEKYSIMVLSLVP-AIAVRMLNSPLLQKYDVSS 303

  Fly   298 MELKAQLQSIRVLIGAGSKVCKAVCRRMYELIGNQRFVVGYGLSEMGGLS--KNVGGPVGCEGKV 360
            :        :.|.:|: :...::..:::.:|:.|...|.|||::|:...:  ::.|.|.|..|::
 Worm   304 L--------VSVTVGS-APFPESASKKLKQLLPNVNIVQGYGMTELTFATHLQSPGSPDGSVGRL 359

  Fly   361 MRNVELRVLDKLKMPLGINEVGIIYARLRFKWAGYYRNPEATRRALSSDGMWFRTGDIGYLDSEG 425
            :....::|..:.....|.:|:|.::.:......||::..:.|...|...| :.|||||.|.|..|
 Worm   360 VPGTSMKVKKEDGTLCGPHEIGELWIKGPQMMKGYWKKEQQTNELLDEHG-FMRTGDIVYFDKNG 423

  Fly   426 YLYIQTRDTDVFKFNNFQIYPEQIEEFILRLPGVSEACVFGIPDAVSTNLTACAVVRTKSPEGER 490
            ..:|..|..::.|.|..|:.|.::|..||....|::.||||:.||.|.......||..:..:.| 
 Worm   424 ETFICDRIKELIKVNAKQVAPAELESVILEHDDVADVCVFGVDDASSGERPVACVVSKRGRDME- 487

  Fly   491 LTADHIRNIVEHHLSGAYHIRGGVYFIDSLPKTPNDKLQRR 531
             |:..|...:...|:...||: .:.|:..:.:|...||.||
 Worm   488 -TSKAIMKHINQKLARYKHIK-EIEFVSEIMRTGTGKLLRR 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17999NP_611517.1 CaiC 25..545 CDD:223395 130/559 (23%)
AFD_class_I 38..529 CDD:302604 126/537 (23%)
acs-7NP_495979.1 CaiC 12..540 CDD:223395 130/553 (24%)
Firefly_Luc_like 35..524 CDD:213279 126/526 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333840at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.