DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KARS and LysRS

Sequence 1:NP_001123561.1 Gene:KARS HGNCID:6215 Length:625 Species:Homo sapiens
Sequence 2:NP_001188571.1 Gene:LysRS FlyBaseID:FBgn0027084 Length:607 Species:Drosophila melanogaster

Alignment Length:617 Identity:406/618 (66%)
Similarity:481/618 (78%) Gaps:20/618 (3%)


Human     1 MLTQAAVRLVRGSLRKTSWAEWGHRELRLGQLAPFTAPHKDKSFSDQRSELKRRLKAEKKVAEKE 65
            |..:.|:|.|:||..:..:.  |.:.|..|  ...:||..:.| ...:.|||||||||:|..||.
  Fly     1 MFARCALRTVQGSWPRCRYT--GIQPLAAG--FHVSAPQMEPS-KQTKLELKRRLKAEQKAKEKA 60

Human    66 AKQKELSEKQLSQATAAATNHTT--DNGVGPEEESVDPNQYYKIRSQAIHQLKVN-GEDPYPHKF 127
            .|           |.||...:|.  ......|||.:.||:|:|:||.|:.:||.: ..|||||||
  Fly    61 EK-----------AAAAPAENTAGKKKSSAAEEEEISPNEYFKLRSAAVQELKRSPATDPYPHKF 114

Human   128 HVDISLTDFIQKYSH-LQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNY 191
            ||..||.|||.||.: |:.|:.|.::.|.||||:||.|.||.|||||||||||||:||||::::|
  Fly   115 HVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRESGAKLIFYDLRGEGVKVQVMASAKSY 179

Human   192 KSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYR 256
            |||.:|....:||||||||||.|:||||||||||::|.||.||||||||||||||||||||||||
  Fly   180 KSEADFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLPHLHFGLKDKETRYR 244

Human   257 QRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMN 321
            |||||||||:.||:||.||:|||:|:|.|||.||||||||||||:|.|||.||||:|:||:|.|:
  Fly   245 QRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFVTHHNDLKMD 309

Human   322 LYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMV 386
            |:||||||||||||||||:|||||||||||||||||||||||||||||||||||.|:|:|||::|
  Fly   310 LFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYADIMDITEQLV 374

Human   387 SGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKIL 451
            |||||.|.|||||.|||:||||...::||||||:|::|::.||:.|.:|.|..:.|.:.||.:.|
  Fly   375 SGMVKAIRGSYKVIYHPEGPEGPEQELDFTPPFKRVSMIKTLEEKLQVKFPAADTFNSPETNQFL 439

Human   452 DDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFEL 516
            ..:|....||||.|||||||||||||||:|..|:||||||:||||||||||:|||..||||||||
  Fly   440 SQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPLAKYHRSIPGLTERFEL 504

Human   517 FVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDR 581
            ||.||||||||||||||:.||:.||:||..||||||||..:||||||:||||||||.|:||||||
  Fly   505 FVAKKEICNAYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSLEYGLPPTGGFGMGIDR 569

Human   582 VAMFLTDSNNIKEVLLFPAMKPEDKKENVATT 613
            :|||||||||||||||||||||||.....|.|
  Fly   570 LAMFLTDSNNIKEVLLFPAMKPEDANRTAAET 601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KARSNP_001123561.1 PLN02502 48..605 CDD:215278 391/561 (70%)
LysRS_N 153..262 CDD:239817 85/109 (78%)
LysRS_core 265..603 CDD:238398 253/338 (75%)
LysRSNP_001188571.1 PLN02502 42..593 CDD:215278 391/562 (70%)
LysRS_N 141..250 CDD:239817 85/109 (78%)
LysRS_core 253..591 CDD:238398 253/338 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C77781659
eggNOG 1 0.900 E1_COG1190
Hieranoid 1 1.000
Homologene 1 1.000 H4053
Inparanoid 1 1.050 800 1.000 Inparanoid score I498
Isobase 1 0.950 0 Normalized mean entropy S299
OMA 1 1.010
OrthoDB 1 1.010 D258797at33208
OrthoFinder 1 1.000 FOG0004389
OrthoInspector 1 1.000 T1075423
orthoMCL 1 0.900 OOG5_126972
Panther 1 1.100 LDO PTHR42918
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1446
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.