DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr23a

DIOPT Version :8

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster

Alignment Length:260 Identity:59/261 (23%)
Similarity:106/261 (41%) Gaps:64/261 (25%)


  Fly   181 YTIVTGGPHFTGYVHM----TLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQEL----------- 230
            |.:.:..|.:...:.:    ||...|.::.:::..:|:...:|.|..|..:|.|           
  Fly   130 YLVCSNAPEYAFRIRIYHLKTLPSFLALQVQIISFILEVMKVNIRVRQTKLQLLILARELSCRWP 194

  Fly   231 --------------RIRQVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVG 281
                          |::.:.....:||||...||..:..||...:....|:..|..|.||   |.
  Fly   195 QRKQKPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSYWLF---VD 256

  Fly   282 IGQQNEEENGSCYRM------LGYLALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKLDDWFP 340
            |..:.       :|:      ||::..|.:    ::..|.::|.::....|:...|:.||..  |
  Fly   257 IRTRP-------WRIYAILLNLGFIFNVAL----QMAAACWHCQQSYNLGRQIGCLISKLVK--P 308

  Fly   341 QKSSL-RPLVE--SLMS----WRIQAKIQFTSGLDVVLSRKVIGLFTSILVNYLLILIQFAMTQK 398
            |.|.| ..||.  ||.:    :.:.||..|:..|.::.|     :|.:: |.||:|||||...::
  Fly   309 QGSKLYNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSS-----MFAAV-VTYLVILIQFMFAER 367

  Fly   399  398
              Fly   368  367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 59/258 (23%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 56/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.