DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr21a

DIOPT Version :8

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster

Alignment Length:448 Identity:85/449 (19%)
Similarity:151/449 (34%) Gaps:185/449 (41%)


  Fly    40 RISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLAK--------ADNLVLSISALELLMST 96
            ::.||..|||....|           |:|.   :|||:.|        .|..:.::..:.||.:.
  Fly   109 QVMWAIFIYSCQTTI-----------VVLV---LRERVKKFVTSPDKRFDEAIYNVIFISLLFTN 159

  Fly    97 LVFGVTVISLQVFARRH---LGIYQRLAALDARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMA 158
            .:       |.|.:.||   :.|::.:..             ||:....|......:...:|.  
  Fly   160 FL-------LPVASWRHGPQVAIFKNMWT-------------NYQYKFFKTTGSPIVFPNLYP-- 202

  Fly   159 INSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNW--- 220
                            |.::||                ..:.:|.|...|.|..|||:|..|   
  Fly   203 ----------------LTWSLC----------------VFSWLLSIAINLSQYFLQPDFRLWYTF 235

  Fly   221 -RFPQLHVQELRIRQVVSMIQ---ELHYL----IQEINRVYALS--------------------- 256
             .:|           :::|:.   .|.|:    ....:|  |||                     
  Fly   236 AYYP-----------IIAMLNCFCSLWYINCNAFGTASR--ALSDALQTTIRGEKPAQKLTEYRH 287

  Fly   257 LWAAMAH---DLAMSTSELY-----ILFGQSV--GIGQQNE-EENGSCYRMLGYLALVMIPPLYK 310
            ||..::|   .|..:.|.:|     ::|..::  ..|..:| .::|:.|:.:|...:|       
  Fly   288 LWVDLSHMMQQLGRAYSNMYGMYCLVIFFTTIIATYGSISEIIDHGATYKEVGLFVIV------- 345

  Fly   311 LLIAPFYCDRTIY----EARRCLRLVEKLDDWFPQK----------SSLRPLVESLMSWRIQAKI 361
                 |||...:|    ||....|.| .||  |..|          ::.:..||.|:       :
  Fly   346 -----FYCMGLLYIICNEAHYASRKV-GLD--FQTKLLNINLTAVDAATQKEVEMLL-------V 395

  Fly   362 QFTSGLDVV-------LSRKVIGLFTSILVNYLLILIQFAMTQKMGEQIEQQKIALQE 412
            .......::       ::|::|....|.:..||::|:||.:|       ||::|..|:
  Fly   396 AINKNPPIMNLDGYANINRELITTNISFMATYLVVLLQFKIT-------EQRRIGQQQ 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 81/432 (19%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 81/439 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.