DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr10b

DIOPT Version :8

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_511121.1 Gene:Gr10b / 32085 FlyBaseID:FBgn0030297 Length:373 Species:Drosophila melanogaster

Alignment Length:258 Identity:52/259 (20%)
Similarity:83/259 (32%) Gaps:90/259 (35%)


  Fly     2 AVLYF----FREPETVFDCAAFICILQFLMGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCLFG 62
            |:.||    ||....|...:......|.||...|          :|...::...|     |..:.
  Fly    63 AMTYFLEGMFRRQGFVNQVSTCNVFQQLLMAVTG----------TWLHFLFERHV-----CQTYN 112

  Fly    63 SLSVLLAEE-DIRER--------LAKADNLVLSIS-ALELLMSTLVFGVTVISLQVFARRHLGIY 117
            .||.:|..: .::|.        |||..|...:.: ||..:|.   :|:...::.........:|
  Fly   113 ELSRILKHDLKLKEHSRFYCLAFLAKVYNFFHNFNFALSAIMH---WGLRPFNVWDLLANLYFVY 174

  Fly   118 QRLAALDARLMSDFGANLNYRKMLRKN-------------------------------IAVLGIV 151
            ..||. ||.|::.....||..:.||.|                               .|.|..:
  Fly   175 NSLAR-DAILVAYVLLLLNLSEALRLNGQQEHDTYSDLMKQLRRRERLLRIGRRVHRMFAWLVAI 238

  Fly   152 TTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGY-VHMTLAEMLGIRFRLLQQLL 213
            ..|||:..|:|.:                         :.|| :.:...:.||:|.|.|:.||
  Fly   239 ALIYLVFFNTATI-------------------------YLGYTMFIQKHDALGLRGRGLKMLL 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 42/225 (19%)
Gr10bNP_511121.1 7tm_7 11..360 CDD:285581 52/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.