DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr2a

DIOPT Version :8

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster

Alignment Length:443 Identity:101/444 (23%)
Similarity:173/444 (39%) Gaps:132/444 (30%)


  Fly    31 GFGIRRSTFRISWASRIYSMSVAIAAFCCLFGSLSV--LLAEEDIRERLAKADNLVLSISALELL 93
            |..:|||    .|. .:|..:|.|||     .|.:|  |..|..:.|: ..:::.:.||      
  Fly    32 GILLRRS----RWL-ELYGWTVLIAA-----TSFTVYGLFQESSVEEK-QDSESTISSI------ 79

  Fly    94 MSTLVFGVTVISLQVFARR--HL--------------GIYQRLAALDARLMSDFGANLNYRKMLR 142
                  |.||..:|:...|  ||              |.:..|..:| ||:|         |.||
  Fly    80 ------GHTVDFIQLVGMRVAHLAALLEALWQRQAQRGFFAELGEID-RLLS---------KALR 128

  Fly   143 KNIAVLGIVTTIYLMAINSAAVQVASGHRALFLL--FALCYTIVTG------GPHFTGYVHMTLA 199
            .::..         |.||   ::..:..||:::|  :|:...::.|      |..|..|....|.
  Fly   129 VDVEA---------MRIN---MRRQTSRRAVWILWGYAVSQLLILGAKLLSRGDRFPIYWISYLL 181

  Fly   200 EML--GIRF-------RLLQQLLQPEFLNWRFPQLH---------------VQELRIRQVVS--- 237
            .:|  |:|:       :|::|.|....:..:..|||               ::|..:.::::   
  Fly   182 PLLVCGLRYFQIFNATQLVRQRLDVLLVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRL 246

  Fly   238 MIQELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYLA- 301
            :.|.:..|:..:||.|.||:...:.:|....||..|.:|       ....:...|.:.:|..:| 
  Fly   247 VYQRVWALVALLNRCYGLSMLMQVGNDFLAITSNCYWMF-------LNFRQSAASPFDILQIVAS 304

  Fly   302 -LVMIPPLYKLLIAPFYCDRTIYEARR---CLR-------------LVEKLDDWFPQKSSLRPLV 349
             :...|.|..:|:....||||...|.|   ||.             ||..|..:......|.||.
  Fly   305 GVWSAPHLGNVLVLSLLCDRTAQCASRLALCLHQVSVDLRNESHNALVGTLVRYCAPLIILVPLQ 369

  Fly   350 ESLMSWR-IQAKIQFTS----GLDVVLSRKVIGLFTSILVNYLLILIQFAMTQ 397
            .:..|.: :..::.|::    .:|..|...::|..|:    ||:|||||.|::
  Fly   370 ITQFSLQLLHQRLHFSAAGFFNVDCTLLYTIVGATTT----YLIILIQFHMSE 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 100/441 (23%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 101/442 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.