DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr28b

DIOPT Version :8

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster

Alignment Length:445 Identity:85/446 (19%)
Similarity:161/446 (36%) Gaps:94/446 (21%)


  Fly     7 FREPETVFDCAAFICILQFLMGCNGF-----------GIRRSTFRISWASRIYSMSVAIAAFCCL 60
            |...:.:::|...:..:.::.|...|           .|:::.|  .:.:.|..:::.:.|:...
  Fly    35 FVTAKQLYECLRPVFHVTYIHGLTSFYISCDTKTGKKAIKKTIF--GYINGIMHIAMFVFAYSLT 97

  Fly    61 FGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHL--GIYQRLAAL 123
            ..:....:|....|.|:....:|:..:|..        .|||||.|..|...|.  ...|:...:
  Fly    98 IYNNCESVASYFFRSRITYFGDLMQIVSGF--------IGVTVIYLTAFVPNHRLERCLQKFHTM 154

  Fly   124 DARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYT---IVT 185
            |.:|.: .|..:.|.|:||.:..||     |.:..:|   |....|      .|::.|:   ..|
  Fly   155 DVQLQT-VGVKIMYSKVLRFSYMVL-----ISMFLVN---VLFTGG------TFSVLYSSEVAPT 204

  Fly   186 GGPHFTGYVHMT--------------LAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIR--- 233
            ...|||..:..|              |.||   |..::.::|:.....|....|.....:.|   
  Fly   205 MALHFTFLIQHTVIAIAIALFSCFTYLVEM---RLVMVNKVLKNLAHQWDTRSLKAVNQKQRSLQ 266

  Fly   234 ----------------QVVSMIQELHYLIQE----INRVYALSLWAAMAHDLAMSTSELYILFGQ 278
                            :::....|:|:||.|    .|:.:...|...::....:...:.|.:.  
  Fly   267 CLDSFSMYTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVL-- 329

  Fly   279 SVGIGQQNEEENGSCYRMLGYLALVMIPPLYKLLIAPFY--CDRTIYEARRCLRLVEKLDDWFPQ 341
            ...:|:...|........:.:.:..||  ||.:.|....  .:|.|.::.:...:|..|    ..
  Fly   330 ETLLGKSKRESKFKTVEFVTFFSCQMI--LYLIAIISIVEGSNRAIKKSEKTGGIVHSL----LN 388

  Fly   342 KSSLRPLVESLMSWRIQ---AKIQFTSGLDVVLSRKVIGLFTSILVNYLLILIQF 393
            |:....:.|.|..:.:|   .||.||:.....:.|.:....:..|..||:||:||
  Fly   389 KTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 82/421 (19%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 82/434 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.