DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr93c

DIOPT Version :8

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster

Alignment Length:447 Identity:95/448 (21%)
Similarity:171/448 (38%) Gaps:136/448 (30%)


  Fly    17 AAFI----CILQFLMG--CNGFGIR--------RSTFRISW---ASRIYSMSVAIAAFCCLFGSL 64
            :|||    |....::|  |...|.|        |:..:..|   :.|:.|:: |:..||..:   
  Fly    14 SAFILFCSCHYGRILGVICFDIGQRTSDDSLVVRNRHQFKWFCLSCRLISVT-AVCCFCAPY--- 74

  Fly    65 SVLLAE-EDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRH--------LGIYQRL 120
               :|: ||..|||.:...          |.::|:.|:.:|.:||...:.        |.:::|:
  Fly    75 ---VADIEDPYERLLQCFR----------LSASLICGICIIVVQVCYEKELLRMIISFLRLFRRV 126

  Fly   121 AALDARLMSDFGANLNYRKMLRKNIAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYTIVT 185
            ..|.:.....||....:..:|.|.|.   :|..:|     |...|:.....:|.|...||...:.
  Fly   127 RRLSSLKRIGFGGKREFFLLLFKFIC---LVYELY-----SEICQLWHLPDSLSLFATLCEIFLE 183

  Fly   186 GGP----H--FTGYVHMTLAEMLG-----IRFRLLQQLLQPEFLNWRFP--------QLHVQELR 231
            .|.    |  |.||  :::|.:..     .|..|.:||...|     .|        ||.:.|.|
  Fly   184 IGSLMIIHIGFVGY--LSVAALYSEVNSFARIELRRQLRSLE-----RPVGGPVGRKQLRIVEYR 241

  Fly   232 IRQVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRM 296
            :.:.:|:..|    |:.:.|.:         |.| :....|.||.|:....            .:
  Fly   242 VDECISVYDE----IERVGRTF---------HRL-LELPVLIILLGKIFAT------------TI 280

  Fly   297 LGYLALVMIPPLY--KL----LIAPFYCD-----RTIYEARRCLRLVEKLD-DWFPQKSSLRPLV 349
            |.| .:::.|.||  |:    |:...:.|     ..::||....|::.:|. :.||        :
  Fly   281 LSY-EVIIRPELYARKIGMWGLVVKSFADVILLTLAVHEAVSSSRMMRRLSLENFP--------I 336

  Fly   350 ESLMSWRIQAKIQFTSGLDVV-----------LSRKVIGLFTSILVNYLLILIQFAM 395
            ....:|.::.:: |.|.|:..           :|.:||.||.|.::.|...::|:.:
  Fly   337 TDHKAWHMKWEM-FLSRLNFFEFRVRPLGLFEVSNEVILLFLSSMITYFTYVVQYGI 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 89/427 (21%)
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 92/444 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21143
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.