DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr57a and Gr98c

DIOPT Version :9

Sequence 1:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:418 Identity:77/418 - (18%)
Similarity:148/418 - (35%) Gaps:125/418 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RSTFRISWAS--RIYSMSVAIAAFCCLFGSLSVLLAE------EDIRERLAKADN-LVLSISALE 91
            |...|..|.:  .:|.:::.:..|.....::..|..|      ||..:.:.:... |:::|:...
  Fly    38 RKRRRFCWMAGYSLYLIAILLMVFYEFHANIVSLHLEIYKFHVEDFSKVMGRTQKFLIVAIATCN 102

  Fly    92 LLMSTLVFGVTVISLQVFARRHLG-IYQRLAALDARLMSDFGANLNYRKMLRKN----------- 144
            .|...|.:|            .|| ||..:|.|      |.|.:.:.:....|:           
  Fly   103 QLNILLNYG------------RLGLIYDEIANL------DLGIDKSSKNFCGKSHWWSFRLRLTL 149

  Fly   145 ------IAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLG 203
                  :.::|::..:                           |:...||.| .:|:..|.::: 
  Fly   150 SIGLWMVIIIGVIPRL---------------------------TLGRAGPFF-HWVNQVLTQII- 185

  Fly   204 IRFRLLQQLLQPEFLNWRFPQLHVQE--LRIRQVV-------------SMIQELHYLIQE----I 249
               .::.||..||:..:   .|.|.|  ||.|.|:             :.||||...:::    |
  Fly   186 ---LIMLQLKGPEYCLF---VLLVYELILRTRHVLEQLKDDLEDFDCGARIQELCVTLKQNQLLI 244

  Fly   250 NRVY-------ALSLWAAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSC-YRMLGYLALVMIP 306
            .|::       |...|:.....|....:.|:::....:    ::.:.|..| ...||.:..:.  
  Fly   245 GRIWRLVDEIGAYFRWSMTLLFLYNGLTILHVVNWAII----RSIDPNDCCQLNRLGSITFLS-- 303

  Fly   307 PLYKLLIAPFY---CDRTIYEARRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQ---AKIQFTS 365
              :.||:..|:   |.:|.......|..:..|    |.....:.|...|..:.:|   .|:.||.
  Fly   304 --FNLLLTCFFSECCVKTYNSISYILHQIGCL----PTAEEFQMLKMGLKEYILQMQHLKLLFTC 362

  Fly   366 GLDVVLSRKVIGLFTSILVNYLLILIQF 393
            |....::.|:.|.....|..|::|::||
  Fly   363 GGLFDINIKLFGGMLVTLCGYVIIIVQF 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 77/418 (18%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 77/418 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.