DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and AT4G03440

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_192253.1 Gene:AT4G03440 AraportID:AT4G03440 Length:751 Species:Arabidopsis thaliana

Alignment Length:367 Identity:87/368 (24%)
Similarity:136/368 (37%) Gaps:96/368 (26%)


  Fly    33 HGMLVEISEEIRAKFPHEPRLRFSQLNNLHLAARS-GQMLS--FVEILNSVSCRAVQTHLVNTNF 94
            |..|.::.|  :.|..||      :..::|...|| .:.||  ...::.:.:|      |||.|.
plant   212 HSALKDLHE--KTKELHE------KTKDMHWLRRSKSKSLSNESTHLMETAAC------LVNANQ 262

  Fly    95 D---QPDGQSLTPLTMAAMMGNVKFVKTLL-SHYDVDLDRECNVI-------------------- 135
            |   ..:...::||.:|...|||..|..:| ||.:...|:..|:.                    
plant   263 DVSFLANKDEISPLYLAVEAGNVSLVNAMLNSHVNNVQDKTFNLATQLKGRKSLVHAALKAKNTD 327

  Fly   136 --------YDGMV----VYGATALWVAAGMGHLQ-IVKMLVQAGAAINHNTKAQSSPLRAACYEG 187
                    |..:|    ..|.|.|.|.|.:|..| |.|:|..:..:|.......|.|:..|..:|
plant   328 VLDVILGKYPSLVKERDEKGRTCLSVGASVGFYQGICKLLDTSTLSIFDCDDDGSFPIHKAVEKG 392

  Fly   188 RLDIVEFLIDNGAD-VNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRAN-------DQALCGAT 244
            ..::|:.|:....| |...|....|...|:|..|...:.  |:::.::.:       :|.:.|.|
plant   393 HENVVKELLKRFPDSVEQLNKEGQNIFHISAKSGKSTLF--LMEHINKVDTKNHLMEEQDMDGNT 455

  Fly   245 ALHYAAESGH----------LDVVVALLDHGATLKKNELGITPALQAAERLHEDVLEAFIERPEL 299
            .||.|..:..          |.:...|||     |.|.:|:.|...|...|..|.:  |.||..|
plant   456 PLHLATINWRPKTVRMLTKFLSIRKKLLD-----KHNSVGLRPLDIAEINLQSDYV--FRERMTL 513

  Fly   300 MSL-------EEQITALELLGATYAN--------DKIKYDVN 326
            |.|       :..|:.|...|.|..:        :|.|..||
plant   514 MVLLGVYNLRQRGISLLPTSGMTLRSRSEKLGDGEKYKDRVN 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 42/175 (24%)
ANK repeat 103..129 CDD:293786 10/27 (37%)
Ank_2 105..206 CDD:289560 32/136 (24%)
ANK 142..262 CDD:238125 33/139 (24%)
ANK repeat 142..173 CDD:293786 11/32 (34%)
ANK repeat 178..206 CDD:293786 7/29 (24%)
Ank_2 180..266 CDD:289560 22/104 (21%)
ANK repeat 208..239 CDD:293786 6/38 (16%)
ANK repeat 241..266 CDD:293786 9/35 (26%)
Ank_4 244..294 CDD:290365 16/60 (27%)
ANK 548..685 CDD:238125
ANK repeat 548..594 CDD:293786
ANK repeat 596..636 CDD:293786
AT4G03440NP_192253.1 ANK 121..292 CDD:238125 24/94 (26%)
Ank_4 125..179 CDD:290365
ANK repeat 125..155 CDD:293786
ANK repeat 157..204 CDD:293786
Ank_2 163..301 CDD:289560 27/103 (26%)
ANK 269..401 CDD:238125 31/132 (23%)
ANK repeat 274..301 CDD:293786 10/27 (37%)
Ank_2 276..406 CDD:289560 30/130 (23%)
ANK 342..472 CDD:238125 31/132 (23%)
ANK repeat 347..378 CDD:293786 11/31 (35%)
ANK repeat 380..412 CDD:293786 8/32 (25%)
Ank_5 400..460 CDD:290568 14/62 (23%)
ANK repeat 414..450 CDD:293786 6/38 (16%)
PGG 548..655 CDD:290670 4/9 (44%)
PotE <557..714 CDD:223605
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.