DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and fem1b

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:XP_695502.4 Gene:fem1b ZFINID:ZDB-GENE-071009-3 Length:638 Species:Danio rerio

Alignment Length:639 Identity:256/640 (40%)
Similarity:369/640 (58%) Gaps:23/640 (4%)


  Fly    61 LHLAARSGQMLSFVEILNSVSCRAVQTHLVNTNFDQPDGQSLTPLTMAAMMGNVKFVKTLLSHYD 125
            :|.||..|::|:...:|.:.|  .|||..:.....|..||..|||.:||..|:.|.|:.||.||.
Zfish    19 VHKAAGEGRVLTLAALLLNHS--TVQTRYLLEFVTQLAGQRSTPLIIAARNGHDKVVRLLLDHYK 81

  Fly   126 VDLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQAGAAINHNTKAQSSPLRAACYEGRLD 190
            ||.::...|.:||.::.||||||.|||.||.::|::||...|.:||.|...|:||||||::||||
Zfish    82 VDTEQTGTVRFDGYIIDGATALWCAAGAGHFEVVRLLVSHNANVNHTTLTNSTPLRAACFDGRLD 146

  Fly   191 IVEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRANDQALCGATALHYAAESGHL 255
            ||.:|:::.||::..|.:.|..|||||||||..||..||:..:..|..|.|||||||:|||:|||
Zfish   147 IVRYLVEHKADISIANKYGNTCLMIAAYKGHTDVVYFLLERRADPNSTAHCGATALHFAAEAGHL 211

  Fly   256 DVVVALLDHGATLKKNELGITPALQAAERLHEDVLEAFIERPELMSLEEQITALELLGATYANDK 320
            ::|..|:...|.:..|..|:||...|||....||:|..:..|: ..::.:|.|||||||::|||:
Zfish   212 EIVKELVRCQAAMVVNGHGMTPLKVAAESCKADVVELLLSHPD-CDVQSRIEALELLGASFANDR 275

  Fly   321 IKYDVNKAYGYLLRAMQLRYSNPRGVIRKRVQPTVPAYDNWLETENLPELYAIKLNHHSIHMESL 385
            ..||:.|.|.||..||..|:.:|...|.|.:...|.||....|..||.:|.||:.:..::|||.|
Zfish   276 ENYDILKTYHYLYLAMLERFRDPDRAISKELPSPVEAYGGRSECRNLQQLEAIRHDRDALHMEGL 340

  Fly   386 AIRERILGRNNPELPQAIIYRGAVMADQGRFYQCQVLWNYAIDLRMRNNVSVDRDLLRFAQLFAQ 450
            .|||||||.:|.::...|||||||.||...|.||..||.:|:.||.:.|.:..:|||||||:|:|
Zfish   341 MIRERILGADNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALQLRQQGNRNTHKDLLRFAQVFSQ 405

  Fly   451 ILRVENHNLTLDHVLPVLAKCQQEIENNKFKIKEAKPNACPSLWQDQNNQNCITALYLIKIVTHL 515
            ::.::...:..| |..||.....||..:..:::.......|:. .|....|..|.|||:.|.|..
Zfish   406 MVHLKEPVIASD-VEHVLRASVLEIRRSMARLQTTTEVELPAA-TDNYESNVFTFLYLVCISTKT 468

  Fly   516 ARRKKDQNIDEEHIQQLFLVVRKFIQNDTRLQDGQTLLHIAVNGVMPVDEFYTNEMCRFPCYATA 580
            ...::.:....:||..|       |:.|.|.::|.:|||:|.:...|||:|:||::|.||.....
Zfish   469 QCGEEQRERINKHIYDL-------IRLDPRSREGSSLLHLAASSSTPVDDFHTNDVCSFPNAQVT 526

  Fly   581 LVLVHCGASVVAVDSDRNTPLHILVTKVNTTQDRQAEMARILELFVEAGAHLDAVNAAGQT---- 641
            .:|:.|||.|.|||.:.|:|||::|.......|.....|.|:.| ||||||.|..|...:|    
Zfish   527 KLLIDCGAQVNAVDHEGNSPLHLIVQYNRPISDFLTLHAIIISL-VEAGAHTDMTNKQKKTPLDK 590

  Fly   642 AATACKLPILANRLHAHQNAHTSLKCLAARSIATNRLNFKGLIPTQLEAFIQMH 695
            :.|.....:|..::      ..||||||||::..:::.::..||..||.|::.|
Zfish   591 STTGVSEILLKTQM------KMSLKCLAARAVQQHQILYRDQIPKSLEEFVEFH 638

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 62/135 (46%)
ANK repeat 103..129 CDD:293786 14/26 (54%)
Ank_2 105..206 CDD:289560 49/101 (49%)
ANK 142..262 CDD:238125 66/120 (55%)
ANK repeat 142..173 CDD:293786 17/31 (55%)
ANK repeat 178..206 CDD:293786 15/28 (54%)
Ank_2 180..266 CDD:289560 46/86 (53%)
ANK repeat 208..239 CDD:293786 15/31 (48%)
ANK repeat 241..266 CDD:293786 15/25 (60%)
Ank_4 244..294 CDD:290365 23/50 (46%)
ANK 548..685 CDD:238125 51/141 (36%)
ANK repeat 548..594 CDD:293786 21/46 (46%)
ANK repeat 596..636 CDD:293786 16/40 (40%)
fem1bXP_695502.4 Ank_2 20..128 CDD:289560 47/110 (43%)
ANK repeat 59..96 CDD:293786 17/37 (46%)
ANK 98..218 CDD:238125 66/120 (55%)
ANK repeat 98..129 CDD:293786 17/31 (55%)
Ank_2 103..194 CDD:289560 46/91 (51%)
ANK repeat 131..162 CDD:293786 16/31 (52%)
ANK repeat 164..192 CDD:293786 14/28 (50%)
Ank_2 169..260 CDD:289560 42/92 (46%)
ANK 489..>588 CDD:238125 42/100 (42%)
ANK repeat 494..540 CDD:293786 21/46 (46%)
ANKYR <500..>589 CDD:223738 37/90 (41%)
ANK repeat 542..581 CDD:293786 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7714
Inparanoid 1 1.050 420 1.000 Inparanoid score I1729
OMA 1 1.010
OrthoDB 1 1.010 D133963at33208
OrthoFinder 1 1.000 FOG0003737
OrthoInspector 1 1.000 T1051741
orthoMCL 1 0.900 OOG5_135030
Panther 1 1.100 LDO PTHR24173
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4569
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.