DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and Fem1a

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001020877.1 Gene:Fem1a RGDID:1561112 Length:654 Species:Rattus norvegicus

Alignment Length:694 Identity:224/695 (32%)
Similarity:348/695 (50%) Gaps:99/695 (14%)


  Fly    60 NLHL----AARSGQMLSFVEILNSVSCRAVQTHLVNTNFDQPDGQSL---TPLTMAAMMGNVKFV 117
            :||.    ||..|::|...::|.......::..|         |:..   |||.:||..|::..|
  Rat     2 DLHTAVYNAAHDGKLLLLQKLLAGRGREEIEELL---------GEVAGGGTPLLIAARRGHLDVV 57

  Fly   118 KTLLSHYDVDLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQAGAAINHNTKAQSSPLRA 182
            :.|:.:....::...:|.:||..:.||..||.|:..|||.:|:.|::.||::|..|:..|:||||
  Rat    58 EYLVDNCGASVEASGSVHFDGETIEGAPPLWAASAAGHLAVVRSLLRRGASVNRTTRTNSTPLRA 122

  Fly   183 ACYEGRLDIVEFLI-DNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRANDQALCGATAL 246
            ||::|.||:|.:|: ::.||:...|...:..|||:.||||..:.:.||:.|::.|.::..|.|||
  Rat   123 ACFDGHLDVVRYLVGEHKADLEVANRHGHTCLMISCYKGHREIARYLLERGAQVNRRSAKGNTAL 187

  Fly   247 HYAAESGHLDVVVALLDHGATLKKNELGITPALQAAERLHEDVLEAFI-ERP--------EL--- 299
            |..||||.|:::..||...|.::::..|:||.|.|:...|.:::|..| |:|        ||   
  Rat   188 HDCAESGSLEILQLLLGCHARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPGHGQLSGTELPGE 252

  Fly   300 ------------------------MSLEEQITALELLGATYANDKIKYDVNKAYGYLLRAMQLRY 340
                                    .|.|..:.|||||||||. || |.|:..|..:..|||:||:
  Rat   253 GSSQMAGNHCSTPEEAEPYESCCPTSREAAVEALELLGATYV-DK-KRDLLGALKHWRRAMELRH 315

  Fly   341 SNPRGVIRKRVQPTVPAYDNWLETENLPELYAIKLNHHSIHMESLAIRERILGRNNPELPQAIIY 405
            .....:.:...|..|.|||...|.....||.|:..:...:.|::|.|||||||.::|:....|.|
  Rat   316 QGGDYLPKPEPQQLVLAYDYSREVSTPQELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRY 380

  Fly   406 RGAVMADQGRFYQCQVLWNYAIDLRMRN----NVSVDRDLLRFAQLFAQIL--RVENHNLTLD-- 462
            ||||.||.|.|.:|..||.||:|::..|    :.......|.||:||:.:|  |....||.:.  
  Rat   381 RGAVYADSGNFERCIRLWKYALDMQQNNLEPLSPMTASSFLSFAELFSYVLQDRSAKGNLGMQLG 445

  Fly   463 --HVLPVLAKCQQEIENNKFKIKEAKPNACPSLWQDQNNQNCITALYLIKIVTHLARRKKDQNID 525
              .::.||:|..:|:|......||...:|       |..:.....|:|:.::     .|.:....
  Rat   446 FADLMGVLSKGVREVERALQLPKEPGDSA-------QFTKAIAIILHLLYLL-----EKVECTPS 498

  Fly   526 EEHIQQLFLVVRKFIQNDTRLQDGQTLLHIAVNGVMPVDEFYTN----EMCRFPCYATALVLVHC 586
            :||::.  ..|.:.::...|.::|.|.||:|      ||:..||    .:..||......||:.|
  Rat   499 QEHLKH--QTVYRLLKCAPRGKNGFTPLHMA------VDKETTNVGRYRVGIFPSLQVVKVLLDC 555

  Fly   587 GASVVAVDSDRNTPLHILVTKVNTTQDRQAEMARILELFVEAGAHLDAVNAAGQTAATACKLPIL 651
            ||...:.|.|.|||||:..         |.....|::..:|||||:||.||..:||.......:|
  Rat   556 GADPDSRDFDNNTPLHVAA---------QNNCPAIMDALIEAGAHMDATNAFKKTAYELLDSKLL 611

  Fly   652 ANRLHAHQNAHTSLKCLAARSIATNRLNFKGLIPTQLEAFIQMH 695
            |.......| :.:|:|||||::..|::.:||.||.:||||||:|
  Rat   612 AKSTMQPFN-YVTLQCLAARALDRNKVPYKGFIPEELEAFIQLH 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 46/142 (32%)
ANK repeat 103..129 CDD:293786 8/26 (31%)
Ank_2 105..206 CDD:289560 37/102 (36%)
ANK 142..262 CDD:238125 51/121 (42%)
ANK repeat 142..173 CDD:293786 13/31 (42%)
ANK repeat 178..206 CDD:293786 13/29 (45%)
Ank_2 180..266 CDD:289560 36/87 (41%)
ANK repeat 208..239 CDD:293786 11/31 (35%)
ANK repeat 241..266 CDD:293786 12/25 (48%)
Ank_4 244..294 CDD:290365 19/50 (38%)
ANK 548..685 CDD:238125 49/141 (35%)
ANK repeat 548..594 CDD:293786 16/50 (32%)
ANK repeat 596..636 CDD:293786 15/40 (38%)
Fem1aNP_001020877.1 ANK 1 2..31 7/29 (24%)
ANK repeat 40..72 CDD:293786 8/32 (25%)
ANK 2 40..70 8/30 (27%)
Ank_4 41..103 CDD:290365 21/62 (34%)
ANK 43..70 CDD:197603 8/27 (30%)
ANK 82..203 CDD:238125 51/121 (42%)
ANK repeat 82..113 CDD:293786 13/31 (42%)
ANK 3 82..111 13/29 (45%)
Ank_2 87..179 CDD:289560 38/92 (41%)
ANK repeat 115..147 CDD:293786 14/32 (44%)
ANK 4 115..145 14/30 (47%)
ANK repeat 149..179 CDD:293786 11/30 (37%)
ANK 5 149..178 11/29 (38%)
ANK 177..>236 CDD:238125 22/59 (37%)
ANK repeat 182..211 CDD:293786 13/29 (45%)
ANK 6 182..211 13/29 (45%)
Ank_4 183..235 CDD:290365 20/52 (38%)
ANK 7 214..243 10/29 (34%)
TPR 1 283..317 19/36 (53%)
TPR 2 375..408 16/33 (48%)
ANK 500..602 CDD:238125 39/119 (33%)
Ank_5 516..573 CDD:290568 24/63 (38%)
ANK repeat 519..563 CDD:293786 16/50 (32%)
ANK 8 519..561 16/48 (33%)
Ank_5 552..605 CDD:290568 24/62 (39%)
ANK repeat 565..596 CDD:293786 15/40 (38%)
ANK 9 565..594 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0508
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D133963at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.