DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and Ankrd46

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001013970.1 Gene:Ankrd46 RGDID:1309382 Length:228 Species:Rattus norvegicus

Alignment Length:137 Identity:41/138 (30%)
Similarity:67/138 (49%) Gaps:12/138 (9%)


  Fly   172 NTKAQSS-PLRAACYEGRLDIVEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRA 235
            |..:|:: ||..||.:|.....:.|:::|.|.|..:......|.:||.:|:..:.:.|.:.|:..
  Rat     7 NDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADP 71

  Fly   236 NDQALCGATALHYAAESGHLDVVVALLDHGATLK-KNELGITPALQAAER-LHEDVLEAFIERPE 298
            ......|.||||..   ||:|.:..|:.:|..:. .|..|.||.:.|..| :::||:..      
  Rat    72 LATDYQGNTALHLC---GHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRL------ 127

  Fly   299 LMSLEEQ 305
            |.|||||
  Rat   128 LESLEEQ 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 8/25 (32%)
ANK repeat 103..129 CDD:293786
Ank_2 105..206 CDD:289560 11/35 (31%)
ANK 142..262 CDD:238125 26/91 (29%)
ANK repeat 142..173 CDD:293786 1/1 (100%)
ANK repeat 178..206 CDD:293786 9/29 (31%)
Ank_2 180..266 CDD:289560 24/86 (28%)
ANK repeat 208..239 CDD:293786 6/31 (19%)
ANK repeat 241..266 CDD:293786 10/25 (40%)
Ank_4 244..294 CDD:290365 17/52 (33%)
ANK 548..685 CDD:238125
ANK repeat 548..594 CDD:293786
ANK repeat 596..636 CDD:293786
Ankrd46NP_001013970.1 ANK 1 11..40 10/29 (34%)
ANK 15..128 CDD:238125 33/122 (27%)
ANK repeat 15..42 CDD:293786 9/27 (33%)
Ank_2 16..105 CDD:289560 24/92 (26%)
ANK repeat 44..75 CDD:293786 6/31 (19%)
ANK 2 44..74 6/30 (20%)
ANK repeat 77..105 CDD:293786 10/31 (32%)
ANK 3 77..103 10/29 (34%)
ANK 4 107..138 13/35 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.