DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and Fem1c

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_775599.1 Gene:Fem1c MGIID:2444737 Length:617 Species:Mus musculus

Alignment Length:652 Identity:230/653 (35%)
Similarity:356/653 (55%) Gaps:65/653 (10%)


  Fly    64 AARSGQMLSFVEILNSVSCRAVQTHLVN--TNFDQPDGQSLTPLTMAAMMGNVKFVKTLLSHYDV 126
            |||.|::....::|.|.| :|..:.|::  ||       ..|||.|||..|::..|:.||.....
Mouse    10 AARDGKLRLLTKLLASKS-KAEVSSLISEKTN-------GATPLLMAARYGHLDMVEFLLEQCSA 66

  Fly   127 DLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQAGAAINHNTKAQSSPLRAACYEGRLDI 191
            .::...:|.:||..:.||..||.|:..|||::|:.|:..||::|:.|...|:||||||::|.|:|
Mouse    67 SIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLNHGASVNNTTLTNSTPLRAACFDGHLEI 131

  Fly   192 VEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRANDQALCGATALHYAAESGHLD 256
            |::|:::.||:..:|...:..|||:.||||..:.:.||:.|:..|.:::.|.||||..||||.||
Mouse   132 VKYLVEHKADLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRKSVKGNTALHDCAESGSLD 196

  Fly   257 VVVALLDHGATLKKNELGITPALQAAERLHEDVLEAFIERPELMSLEEQITALELLGATYANDKI 321
            ::..||.:.|.::|:..|:||.|.|:...|.:::: |:......|..|:|.||||||||:. || 
Mouse   197 IMKMLLMYCAKMEKDGYGMTPLLSASVTGHTNIVD-FLTHHAQTSKTERINALELLGATFV-DK- 258

  Fly   322 KYDVNKAYGYLLRAMQLRYSNPRGVIRKRV-QPTVPAYDNWLETENLPELYAIKLNHHSIHMESL 385
            |.|:..|..|..:||.:|||:...:|.|.| |..:.|||...|..:..||..:..:...:.|::|
Mouse   259 KRDLLGALKYWKKAMNMRYSDRTNIISKPVPQTLIMAYDYAKEVNSAEELEGLIADPDEMRMQAL 323

  Fly   386 AIRERILGRNNPELPQAIIYRGAVMADQGRFYQCQVLWNYAIDLRMRN----NVSVDRDLLRFAQ 446
            .|||||||.::|:....|.|||||.||.|.|.:|..||.||:|::..|    :......||.||:
Mouse   324 LIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSPMTASSLLSFAE 388

  Fly   447 LFAQILRVENHNL-----TLDHVLPVLAKCQQEIENNKFKIKEAKPNACPSLWQD--QNNQNCIT 504
            ||:.:|:.....|     |.|.::.:|.|...|||      :..|...||:   |  |.|:....
Mouse   389 LFSFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIE------RAIKQTQCPA---DPLQLNKALSI 444

  Fly   505 ALYLIKIVTHLARRKKDQNIDEEHIQQLFLVVRKFIQNDTRLQDGQTLLHIAVN------GVMPV 563
            .|:||.::     .|....::::|.::  ..:.:|::...|.::..:.||:||:      |..||
Mouse   445 ILHLICLL-----EKVPCTVEQDHFKK--QTIYRFLKLHPRGKNNFSPLHLAVDKNTTCVGRYPV 502

  Fly   564 DEFYTNEMCRFPCYATALVLVHCGASVVAVDSDRNTPLHILVTKVNTTQDRQAEMARILELFVEA 628
                    |:||......:|:.|||.|...|||.|:||||  ..:|...|       |:.|.:::
Mouse   503 --------CKFPSLQVTAILIECGADVNVRDSDDNSPLHI--AALNNHPD-------IMNLLIKS 550

  Fly   629 GAHLDAVNAAGQTAATACKLPILANRLHAHQNAHTSLKCLAARSIATNRLNFKGLIPTQLEAFIQ 693
            |||.||.|...|||:.......:|..|....| ||:|:|||||.|..:|:.:||.||.:||.|:.
Mouse   551 GAHFDATNLHKQTASDLLDEKEIAKNLIQPIN-HTTLQCLAARVIVNHRIYYKGNIPEKLETFVS 614

  Fly   694 MH 695
            :|
Mouse   615 LH 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 50/134 (37%)
ANK repeat 103..129 CDD:293786 10/26 (38%)
Ank_2 105..206 CDD:289560 39/101 (39%)
ANK 142..262 CDD:238125 52/120 (43%)
ANK repeat 142..173 CDD:293786 13/31 (42%)
ANK repeat 178..206 CDD:293786 13/28 (46%)
Ank_2 180..266 CDD:289560 37/86 (43%)
ANK repeat 208..239 CDD:293786 11/31 (35%)
ANK repeat 241..266 CDD:293786 13/25 (52%)
Ank_4 244..294 CDD:290365 21/50 (42%)
ANK 548..685 CDD:238125 52/143 (36%)
ANK repeat 548..594 CDD:293786 15/52 (29%)
ANK repeat 596..636 CDD:293786 15/40 (38%)
Fem1cNP_775599.1 ANK 1 2..31 8/22 (36%)
Ank_2 10..112 CDD:289560 37/110 (34%)
ANK repeat 40..75 CDD:293786 12/42 (29%)
ANK 2 40..70 11/37 (30%)
ANK 73..202 CDD:238125 55/129 (43%)
ANK repeat 82..113 CDD:293786 13/31 (42%)
ANK 3 82..111 13/29 (45%)
Ank_2 87..178 CDD:289560 38/91 (42%)
ANK 4 115..144 14/29 (48%)
ANK repeat 118..146 CDD:293786 13/28 (46%)
ANK repeat 148..179 CDD:293786 11/31 (35%)
ANK 5 148..177 11/29 (38%)
ANK 176..>236 CDD:238125 23/61 (38%)
ANK 6 181..210 14/29 (48%)
ANK repeat 181..209 CDD:293786 14/28 (50%)
Ank_4 182..233 CDD:290365 22/52 (42%)
ANK 7 213..242 8/30 (27%)
TPR 1 245..279 20/36 (56%)
TPR 2 338..371 16/33 (48%)
ANK <478..578 CDD:238125 39/117 (33%)
ANK repeat 481..525 CDD:293786 15/52 (29%)
ANK 8 481..523 15/50 (30%)
Ank_4 482..548 CDD:290365 27/83 (33%)
ANK repeat 527..558 CDD:293786 15/40 (38%)
ANK 9 527..556 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0508
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D133963at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.