DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and F40E12.2

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001352250.1 Gene:F40E12.2 WormBaseID:WBGene00018235 Length:1294 Species:Caenorhabditis elegans

Alignment Length:810 Identity:162/811 (20%)
Similarity:284/811 (35%) Gaps:236/811 (29%)


  Fly    34 GMLVEISEEIRAKFPHEPRLRFSQLNNLHLAARSGQMLSFVE-----ILNS-VSCRAVQTHLVNT 92
            |:.:|:::.:|.|. .:...:...|.:|.....|..:..|||     ||.. ||...|       
 Worm   135 GIWMEVTKSLRQKL-KDGLDKIKVLQSLVDETNSKTLQYFVEDFEVTILEKLVSFETV------- 191

  Fly    93 NFDQPDGQSLTPLTMAAMMGNVKFVKTLLS----------HYDVDLDRECNVIYDGMVVYGATA- 146
            .|:|   .|:..|..:  :.|..|:.|.:|          |:      :.|.:.:|:   .||| 
 Worm   192 TFNQ---MSIRDLVYS--IENFMFLSTTISPVLKTISQSTHF------KMNALLEGI---NATAE 242

  Fly   147 LWVAA---GMGHLQIVKMLVQAGAAINHNTKAQS---SPLRAACYEGRLDIVEFLIDNGADVN-A 204
            ::..|   ||.:.....:.:||       .|.||   ||........||...|....:.:.:. |
 Worm   243 IYENASEIGMLNPMFQNIKIQA-------QKFQSLLASPETIEKLLSRLIFFENFKQHPSTIPIA 300

  Fly   205 TNLFNNNTLMIAAYKGHHLVVKTLLQNGSRAND------QALCGATALHYAAESG---------- 253
            |...:..|:.:.........|:|:|..|...:|      ..|..|.:|....:..          
 Worm   301 TAFLSTRTVSLVEKDLKDSWVRTVLNKGMDLDDLKAYLVDFLTSANSLEKVNKDSVPMFNSSVIE 365

  Fly   254 HLDVVVALLDHGATLKK--NELGITP--------------ALQAAERLHEDVLEAFIERPELMSL 302
            .||..:||::....:||  .::.:|.              .....|.....|:|.|...|::|:.
 Worm   366 SLDYTLALINSLRVIKKVPKDMFLTDFNSCFKVLSSTSIVDYNETELFETSVVELFKTPPKVMAD 430

  Fly   303 EEQITALELLGATYANDKIKYDVN-----------KAYGYLLRAMQLRYSNPRGVIRKRVQPT-- 354
            .|.::..|....:..  |.|.|:|           |:.| .|:||:..:...|.:.:...|.|  
 Worm   431 LETLSQDEDFSKSIY--KFKDDLNNMRTEAEFATWKSRG-SLKAMKEYFEGHRKLFKSLKQETSF 492

  Fly   355 -------------VPAYDNWLETENLP--------ELYAIKLNHHSIHMESLAIRERILGRNNPE 398
                         :....:|:....|.        ||.|..:  ..::..|..| .||..:|:.|
 Worm   493 IESVNVLLRSKQKITEISSWMANAKLGTPACDFLFELDASMI--QEVNRMSSRI-SRIRTKNDFE 554

  Fly   399 LPQAIIYRGAVMADQGRFYQC--QVLWNYAIDLRMRNNVSV-----DRDLLRF---AQLFAQILR 453
            ..::::  .||: |..:..:.  .:..|.:...|.|.:.:.     .:.||.|   |..|.||.:
 Worm   555 NVKSLV--NAVL-DSTKSLKTIPNLNGNSSNSTRRRRSPTKKFNGDPKKLLNFAFAAHSFYQIGQ 616

  Fly   454 VENHNLTLDHVLPVLAKCQQEIENNKFKIKEAKPNA-CPSLWQDQNNQNCITALYLIKI----VT 513
            ::.::..||.::..:.....||:    |||..|... ...:|  :|:.:.:..|..:|.    :.
 Worm   617 IKKYSADLDLLIKKIPSVPDEIK----KIKNPKVKTDLEMIW--KNSASFVKFLINLKASNKRIL 675

  Fly   514 HLARRKKDQNIDEEHIQ-QLF--------LVVRKFIQN----DTRLQDGQTLLHIAVNG------ 559
            :|.:.|.::.::|..:| :||        ..:||..::    ||.:.|.:..|....:.      
 Worm   676 NLVKSKPEKTLEEVGLQYKLFSSAALTGKFELRKLRESMKLLDTPMDDVEDALKTLEDSASMDWN 740

  Fly   560 -------VMPVD---------EFYTNEMC-------RFPCY----ATALVLVHCGASVVAV---- 593
                   .:|.|         :|:..|..       :...|    ..||||:..||:|.|.    
 Worm   741 LVFSNFKTIPTDLEDIQKQLLDFFEGEHLDDEVEGWKLAVYIGAGVLALVLIGVGAAVFAYWWIL 805

  Fly   594 --DSDRNT--PLHILVTKVNTT-------QDRQAEM---------ARILEL-----------FVE 627
              |.|..:  |...:.|.....       ||.:.|.         .:|.:|           .|:
 Worm   806 IRDPDMRSMVPKEKIYTAPEEVDYSYMQLQDSRLESNSRFGEGYGTKIFDLCERKQWEKVEKMVK 870

  Fly   628 AGAHLDAVNAA-GQTAATACKLPILANRLH 656
            |||.||..|.. |:|.     |.:....||
 Worm   871 AGALLDVCNGLDGKTC-----LHVAIENLH 895

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 37/158 (23%)
ANK repeat 103..129 CDD:293786 6/36 (17%)
Ank_2 105..206 CDD:289560 26/119 (22%)
ANK 142..262 CDD:238125 31/144 (22%)
ANK repeat 142..173 CDD:293786 8/35 (23%)
ANK repeat 178..206 CDD:293786 7/29 (24%)
Ank_2 180..266 CDD:289560 18/103 (17%)
ANK repeat 208..239 CDD:293786 6/37 (16%)
ANK repeat 241..266 CDD:293786 6/35 (17%)
Ank_4 244..294 CDD:290365 12/76 (16%)
ANK 548..685 CDD:238125 36/179 (20%)
ANK repeat 548..594 CDD:293786 15/85 (18%)
ANK repeat 596..636 CDD:293786 14/69 (20%)
F40E12.2NP_001352250.1 WSN 44..113 CDD:197734
ANK 857..>926 CDD:238125 12/45 (27%)
ANK repeat 882..913 CDD:293786 5/20 (25%)
BRCT 1087..1187 CDD:306918
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D133963at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.