DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and LONRF2

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_940863.3 Gene:LONRF2 HGNCID:24788 Length:754 Species:Homo sapiens

Alignment Length:461 Identity:89/462 (19%)
Similarity:147/462 (32%) Gaps:163/462 (35%)


  Fly   229 LQNGS---RANDQALCGATALHYAAESGHLDVVVALLDHGATLKKNELGITPALQAAERLHEDVL 290
            |:.|.   ||.|..:  |..|..:..:|     :|..|.|..|:..:     ||..|.||.| .|
Human    27 LEEGDEAFRAGDYEM--AAELFRSMLAG-----LAQPDRGLCLRLGD-----ALARAGRLPE-AL 78

  Fly   291 EAFIERPELMSLEEQITALELLGATYANDKIKYDVNKAYGYLLRAMQLR-----YSNPRGVIRKR 350
            .||.....|.:|..:                  ::.:..|.|:||:.||     ..||.|     
Human    79 GAFRGAARLGALRPE------------------ELEELAGGLVRAVGLRDRPLSAENPGG----- 120

  Fly   351 VQPTVPAYDNWLETENLPELYA----------IKLNHHSIHME-SLAIRERILGRNNPELPQAII 404
             :|..|.     |....||..|          .:|.|..:.:. .|.:.:|.: ...|..||.  
Human   121 -EPEAPG-----EGGPAPEPRAPRDLLGCPRCRRLLHKPVTLPCGLTVCKRCV-EPGPARPQV-- 176

  Fly   405 YRGAVMADQGRFYQCQVLWNYAIDLRMRNNVSVDRDLLRFAQLFAQILRVENHNLTLDHVLPVLA 469
             |...:...|...:|     :..:.|:|......|.|.|..|..|.:||                
Human   177 -RRVNVVLSGLLEKC-----FPAECRLRRLAGQARSLQRQQQPEAALLR---------------- 219

  Fly   470 KCQQEIENNKFKIKEAKPNACPSLWQDQNNQNCITALYLIKIVTHLARRKKDQNIDEEHIQQLFL 534
             |.|.:|                |..|.|      :|.|::...:|..:..:|.:.:        
Human   220 -CDQALE----------------LAPDDN------SLLLLRAELYLTMKNYEQALQD-------- 253

  Fly   535 VVRKFIQNDTRLQDGQTLLHIAVNGVMPVDEFYTNEMCRFPCYATALVLVHCGASVVAVDSDRNT 599
             .....||:..|..|..:...|::|:....|....             .::|    :|::.:.| 
Human   254 -ASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKE-------------FLYC----LALNPECN- 299

  Fly   600 PLHILVTKVNTTQDRQAEMARILELFVEAGAHLDAVNAAGQTAATACKLPILANRL----HAHQN 660
                     :..::.|..|..:| ....|..|.:..::             :.:||    |:|.|
Human   300 ---------SVKKEAQKVMCEVL-FSATANVHENLTSS-------------IQSRLKAQGHSHMN 341

  Fly   661 AHTSLK 666
            |...|:
Human   342 AQALLE 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125
ANK repeat 103..129 CDD:293786
Ank_2 105..206 CDD:289560
ANK 142..262 CDD:238125 9/36 (25%)
ANK repeat 142..173 CDD:293786
ANK repeat 178..206 CDD:293786
Ank_2 180..266 CDD:289560 11/40 (28%)
ANK repeat 208..239 CDD:293786 5/13 (38%)
ANK repeat 241..266 CDD:293786 6/25 (24%)
Ank_4 244..294 CDD:290365 15/50 (30%)
ANK 548..685 CDD:238125 19/124 (15%)
ANK repeat 548..594 CDD:293786 6/46 (13%)
ANK repeat 596..636 CDD:293786 6/40 (15%)
LONRF2NP_940863.3 TPR 1 23..58 10/38 (26%)
TPR_16 27..92 CDD:290168 23/78 (29%)
PPR repeat 58..82 CDD:276811 11/30 (37%)
TPR 2 59..91 13/38 (34%)
RING 143..>167 CDD:302633 4/24 (17%)
TPR 3 197..230 13/66 (20%)
TPR repeat 200..225 CDD:276809 9/42 (21%)
TPR_11 203..262 CDD:290150 19/107 (18%)
TPR repeat 230..260 CDD:276809 6/45 (13%)
TPR 4 231..264 7/48 (15%)
TPR_11 <244..296 CDD:290150 10/78 (13%)
TPR repeat 265..293 CDD:276809 5/45 (11%)
TPR 5 266..298 6/49 (12%)
TPR 6 447..483
RING 448..487 CDD:238093
LON 528..733 CDD:271862
LON_substr_bdg 538..738 CDD:280370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.