DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and Fem1a

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_034322.3 Gene:Fem1a MGIID:1335089 Length:654 Species:Mus musculus

Alignment Length:734 Identity:233/735 (32%)
Similarity:354/735 (48%) Gaps:132/735 (18%)


  Fly    13 EAHTSIYDGYPPDFGYFNMAHGMLVEISEEIRAKFPHEPRLRFSQLNNLHLAARSGQMLSFVEIL 77
            :.||::|          |.||.          .|.|...:|         ||.|..:.|.  |:|
Mouse     2 DLHTAVY----------NAAHD----------GKLPLLQKL---------LAGRGREELE--ELL 35

  Fly    78 NSVSCRAVQTHLVNTNFDQPDGQSLTPLTMAAMMGNVKFVKTLLSHYDVDLDRECNVIYDGMVVY 142
            ..|:...                  |||.:||..|::..|:.|:.|....::...:|.:||..:.
Mouse    36 GEVAGGG------------------TPLLIAARRGHLDVVEYLVDHCGASVEASGSVHFDGETIE 82

  Fly   143 GATALWVAAGMGHLQIVKMLVQAGAAINHNTKAQSSPLRAACYEGRLDIVEFLI-DNGADVNATN 206
            ||..||.|:..|||.:|:.|::.||::|..|:..|:||||||::|.||:|.:|: ::.||:...|
Mouse    83 GAPPLWAASAAGHLAVVRSLLRRGASVNRTTRTNSTPLRAACFDGHLDVVRYLVGEHKADLEVAN 147

  Fly   207 LFNNNTLMIAAYKGHHLVVKTLLQNGSRANDQALCGATALHYAAESGHLDVVVALLDHGATLKKN 271
            ...:..|||:.||||..:.:.||:.|::.|.::..|.||||..||||.|:::..||...|.::::
Mouse   148 RHGHTCLMISCYKGHREIARYLLERGAQVNRRSAKGNTALHDCAESGSLEILQLLLGCHARMERD 212

  Fly   272 ELGITPALQAAERLHEDVLEAFI-ERP--------EL---------------------------M 300
            ..|:||.|.|:...|.:::|..| |:|        ||                           .
Mouse   213 GYGMTPLLAASVTGHTNIVEYLIQEQPGHEQLSGTELPGEGSSQVAGNHCSTPEEAEPYESCCPT 277

  Fly   301 SLEEQITALELLGATYANDKIKYDVNKAYGYLLRAMQLRYSNPRGVIRKRVQPTVPAYDNWLETE 365
            |.|..:.|||||||||. || |.|:..|..:..|||:||:.....:.:...|..|.|||...|..
Mouse   278 SREAAVEALELLGATYV-DK-KRDLLGALKHWRRAMELRHQGGGYLPKPEPQQLVLAYDYSREVT 340

  Fly   366 NLPELYAIKLNHHSIHMESLAIRERILGRNNPELPQAIIYRGAVMADQGRFYQCQVLWNYAIDLR 430
            ...||.|:..:...:.|::|.|||||||.::|:....|.|||||.||.|.|.:|..||.||:|::
Mouse   341 TPQELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQ 405

  Fly   431 MRN----NVSVDRDLLRFAQLFAQIL--RVENHNLTLD----HVLPVLAKCQQEIENNKFKIKEA 485
            ..|    :.......|.||:||:.:|  |....||.:.    .::.||:|..:|:|......||.
Mouse   406 QNNLEPLSPMTASSFLSFAELFSYVLQDRSAKGNLGMQLGFADLMGVLSKGVREVERALQLPKEP 470

  Fly   486 KPNACPSLWQDQNNQNCITALYLIKIVTHLARRKKDQNIDEEHIQQLFLVVRKFIQNDTRLQDGQ 550
            ..:|       |..:.....|:|:.::     .|.:....:||::.  ..|.:.::...|.::|.
Mouse   471 GDSA-------QFTKAIAIILHLLYLL-----EKVECTPSQEHLKH--QTVYRLLKCAPRGKNGF 521

  Fly   551 TLLHIAVNGVMPVDEFYTN----EMCRFPCYATALVLVHCGASVVAVDSDRNTPLHILVTKVNTT 611
            |.||:|      ||:..||    .:..||......||:.|||...:.|.|.||||||..      
Mouse   522 TPLHMA------VDKETTNVGRYRVGVFPSLQVVKVLLDCGADPDSRDFDNNTPLHIAA------ 574

  Fly   612 QDRQAEMARILELFVEAGAHLDAVNAAGQTAATACKLPILANRLHAHQNAHTSLKCLAARSIATN 676
               |.....|::..:|||||:||.||..:||.......:||.......| :.:|:|||||::..|
Mouse   575 ---QNNCPAIMDALIEAGAHMDATNAFKKTAYELLDSKLLAKSTVQPFN-YVTLQCLAARALDRN 635

  Fly   677 RLNFKGLIPTQLEAFIQMH 695
            ::.:||.||.:||||||:|
Mouse   636 KVPYKGFIPEELEAFIQLH 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 45/135 (33%)
ANK repeat 103..129 CDD:293786 9/26 (35%)
Ank_2 105..206 CDD:289560 38/102 (37%)
ANK 142..262 CDD:238125 51/121 (42%)
ANK repeat 142..173 CDD:293786 13/31 (42%)
ANK repeat 178..206 CDD:293786 13/29 (45%)
Ank_2 180..266 CDD:289560 36/87 (41%)
ANK repeat 208..239 CDD:293786 11/31 (35%)
ANK repeat 241..266 CDD:293786 12/25 (48%)
Ank_4 244..294 CDD:290365 19/50 (38%)
ANK 548..685 CDD:238125 50/141 (35%)
ANK repeat 548..594 CDD:293786 16/50 (32%)
ANK repeat 596..636 CDD:293786 16/40 (40%)
Fem1aNP_034322.3 ANK repeat 2..33 CDD:293786 13/62 (21%)
ANK 1 2..31 12/58 (21%)
Ank_2 3..112 CDD:289560 41/158 (26%)
ANK repeat 40..72 CDD:293786 9/50 (18%)
ANK 2 40..70 9/48 (19%)
ANK 43..70 CDD:197603 9/27 (33%)
ANK 82..203 CDD:238125 51/121 (42%)
ANK repeat 82..113 CDD:293786 13/31 (42%)
ANK 3 82..111 13/29 (45%)
Ank_2 87..179 CDD:289560 38/92 (41%)
ANK repeat 115..147 CDD:293786 14/32 (44%)
ANK 4 115..145 14/30 (47%)
ANK repeat 149..179 CDD:293786 11/30 (37%)
ANK 5 149..178 11/29 (38%)
ANK 177..>236 CDD:238125 22/59 (37%)
ANK repeat 182..211 CDD:293786 13/29 (45%)
ANK 6 182..211 13/29 (45%)
Ank_4 183..235 CDD:290365 20/52 (38%)
ANK 7 214..243 10/29 (34%)
TPR 1 283..317 19/36 (53%)
TPR 2 375..408 16/33 (48%)
ANK 500..602 CDD:238125 40/119 (34%)
Ank_5 516..573 CDD:290568 25/63 (40%)
ANK repeat 519..563 CDD:293786 16/50 (32%)
ANK 8 519..561 16/48 (33%)
Ank_5 552..605 CDD:290568 25/62 (40%)
ANK repeat 565..596 CDD:293786 16/40 (40%)
ANK 9 565..594 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0508
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D133963at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.