DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Fem-1 and fem1b

Sequence 1:NP_611508.1 Gene:Fem-1 FlyBaseID:FBgn0034542 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001238770.1 Gene:fem1b XenbaseID:XB-GENE-999856 Length:629 Species:Xenopus tropicalis

Alignment Length:644 Identity:258/645 (40%)
Similarity:382/645 (59%) Gaps:33/645 (5%)


  Fly    61 LHLAARSGQMLSFVEILNSVSCRAVQTHLVNTNFDQPDGQSLTPLTMAAMMGNVKFVKTLLSHYD 125
            ::.||..|::|:...:|.:.:...::|.|  :...|..||..|||.:||..|:.|.|:.||.||.
 Frog    10 VYKAAAEGRVLTLAALLLNRTEPEIRTLL--STVTQHGGQRSTPLIIAARNGHSKVVRLLLEHYK 72

  Fly   126 VDLDRECNVIYDGMVVYGATALWVAAGMGHLQIVKMLVQAGAAINHNTKAQSSPLRAACYEGRLD 190
            ||:.:...|.:||.::.||||||.|||.||.::||:||..||.:||.|...|:||||||::||||
 Frog    73 VDVQQTGTVRFDGYIIDGATALWCAAGAGHYEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLD 137

  Fly   191 IVEFLIDNGADVNATNLFNNNTLMIAAYKGHHLVVKTLLQNGSRANDQALCGATALHYAAESGHL 255
            ||.||::|.|:::..|.::|..|||||||||..||:.||:..:..|.:|.|||||||:|||:|||
 Frog   138 IVRFLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQHADPNARAHCGATALHFAAEAGHL 202

  Fly   256 DVVVALLDHGATLKKNELGITPALQAAERLHEDVLEAFIERPELMSLEEQITALELLGATYANDK 320
            |:|..|:...|.:..|..|:||...|||....:|:|..:...: ...:.:|.|||||||::|||:
 Frog   203 DIVRELVKWKAAMVVNGHGMTPLKVAAESCKAEVVELLLAHSD-CDTKSRIEALELLGASFANDR 266

  Fly   321 IKYDVNKAYGYLLRAMQLRYSNPRGVIRKRVQPTVPAYDNWLETENLPELYAIKLNHHSIHMESL 385
            ..|::.|.|.||..||..|:.:|..::.|.|.|.:.||....|.....||.||..|..::|||.|
 Frog   267 ENYNLTKTYQYLYLAMLERFRDPSNILHKEVLPPIEAYGMRTECRTPQELGAIIHNTDALHMEGL 331

  Fly   386 AIRERILGRNNPELPQAIIYRGAVMADQGRFYQCQVLWNYAIDLRMRNNVSVDRDLLRFAQLFAQ 450
            .:||||||.:|.::...|||||||.||..:|.||..||.:|:.||.:.|.:..:|||||||:|:|
 Frog   332 IVRERILGSDNIDVSHPIIYRGAVYADNMQFEQCIKLWLHALQLRQKGNRNTHKDLLRFAQVFSQ 396

  Fly   451 ILRVEN--HNLTLDHVLPVLAKCQ-QEIENNKFKIKE-AKPNACPSLWQDQNNQ-NCITALYLIK 510
            ::.:..  .:..::|||    :|. .|||....:::. .:|:|..:|   :|:: |..|.|||:.
 Frog   397 MIHLNEPVKSWDVEHVL----ECSVLEIERGISRVQNPQEPDAHSAL---ENHECNLYTFLYLVC 454

  Fly   511 IVTHLARRKKDQNIDEEHIQQLFLVVRKFIQNDTRLQDGQTLLHIAVNGVMPVDEFYTNEMCRFP 575
            |.|.....:::|....:.|.:|       :..|.|.::|.||||:||:...|||:|:||::|.||
 Frog   455 ISTKTRCSEEEQPRINKQIYRL-------VHLDPRTREGCTLLHLAVDSGTPVDDFHTNDVCSFP 512

  Fly   576 CYATALVLVHCGASVVAVDSDRNTPLHILVTKVNTTQDRQAEMARILELFVEAGAHLDAVNAAGQ 640
            ....|.:|:.|||:|.|||...|:|||::|.......|.....|.|:.| ||||||.|..|...:
 Frog   513 SAPVAKLLIDCGANVNAVDQMGNSPLHVIVQYNRPISDFLTLHAIIISL-VEAGAHTDMTNKEKK 576

  Fly   641 T----AATACKLPILANRLHAHQNAHTSLKCLAARSIATNRLNFKGLIPTQLEAFIQMH 695
            |    :.|.....:|..::      ..||||||||::..:.:.::..||..||.|::.|
 Frog   577 TPLDRSTTGVSEILLKTQM------KLSLKCLAARAVRLHNIKYQNQIPRTLEEFVEFH 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Fem-1NP_611508.1 ANK 61..196 CDD:238125 62/135 (46%)
ANK repeat 103..129 CDD:293786 14/26 (54%)
Ank_2 105..206 CDD:289560 52/101 (51%)
ANK 142..262 CDD:238125 70/120 (58%)
ANK repeat 142..173 CDD:293786 19/31 (61%)
ANK repeat 178..206 CDD:293786 16/28 (57%)
Ank_2 180..266 CDD:289560 48/86 (56%)
ANK repeat 208..239 CDD:293786 15/31 (48%)
ANK repeat 241..266 CDD:293786 16/25 (64%)
Ank_4 244..294 CDD:290365 23/50 (46%)
ANK 548..685 CDD:238125 54/141 (38%)
ANK repeat 548..594 CDD:293786 24/46 (52%)
ANK repeat 596..636 CDD:293786 16/40 (40%)
fem1bNP_001238770.1 Ank_2 13..119 CDD:289560 46/108 (43%)
ANK repeat 50..87 CDD:293786 17/37 (46%)
ANK 89..209 CDD:238125 70/120 (58%)
ANK repeat 89..120 CDD:293786 19/31 (61%)
Ank_2 94..185 CDD:289560 49/91 (54%)
ANK repeat 122..153 CDD:293786 17/31 (55%)
ANK repeat 155..185 CDD:293786 15/30 (50%)
Ank_5 175..228 CDD:290568 25/53 (47%)
ANK repeat 188..213 CDD:293786 16/25 (64%)
ANK <473..580 CDD:238125 47/115 (41%)
ANK repeat 485..531 CDD:293786 24/46 (52%)
ANK repeat 533..572 CDD:293786 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0508
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7714
Inparanoid 1 1.050 423 1.000 Inparanoid score I1641
OMA 1 1.010
OrthoDB 1 1.010 D133963at33208
OrthoFinder 1 1.000 FOG0003737
OrthoInspector 1 1.000 T1058380
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4569
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.