DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and CG9240

DIOPT Version :8

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster

Alignment Length:157 Identity:52/158 (33%)
Similarity:74/158 (47%) Gaps:24/158 (15%)


  Fly     4 RFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLL-RWGTHNSQVERGDII 67
            |....::.||.....|| :.:|......|.||:|.|:     .|.|.|. |...|....:.|||:
  Fly     9 RLMRYTVAYAAITHCTF-EYIGDFVLCKGPSMEPTLH-----SDNVLLTERLSKHWRTYQPGDIV 67

  Fly    68 SLISPKDPAQKIIKRVVGLQGDVV---------------STLGYKHEIVR--VPEGHCWVEGDHT 115
            ..|||....|.|.||:|.:.||.|               |....|..:|:  ||.||.|:|||:.
  Fly    68 IAISPIKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDNK 132

  Fly   116 GHSMDSNTFGPVALGLMSARAVAIVWP 142
            |:|.||..:||:.:||:.:|.:..:||
  Fly   133 GNSSDSRYYGPIPVGLIRSRVLCRIWP 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 45/133 (34%)
S26_SPase_I 27..136 CDD:119398 44/127 (35%)
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 45/134 (34%)
S26_SPase_I 31..153 CDD:119398 44/127 (35%)
Peptidase_S24_S26 <81..145 CDD:299172 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2372713
eggNOG 1 0.900 E1_COG0681
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1211147at2759
OrthoFinder 1 1.000 FOG0001147
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.