DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and IMMP1L

DIOPT Version :8

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:NP_001291203.1 Gene:IMMP1L / 196294 HGNCID:26317 Length:166 Species:Homo sapiens

Alignment Length:145 Identity:53/146 (36%)
Similarity:72/146 (49%) Gaps:12/146 (8%)


  Fly     3 FRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVFLLRWGTHNSQVERGDII 67
            ||..|.::.|.......| :.||.|....|.||:|.:    ...|.||......|...::||||:
Human    10 FRLVGYTIQYGCIAHCAF-EYVGGVVMCSGPSMEPTI----QNSDIVFAENLSRHFYGIQRGDIV 69

  Fly    68 SLISPKDPAQKIIKRVVGLQGDVVSTLG----YK-HEIVRVPEGHCWVEGDHTGHSMDSNTFGPV 127
            ...||.||...|.|||:||:||.:.|..    :| |..  ||.||.|:|||:..:|.||..:||:
Human    70 IAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSY--VPMGHVWLEGDNLQNSTDSRCYGPI 132

  Fly   128 ALGLMSARAVAIVWP 142
            ..||:..|....:||
Human   133 PYGLIRGRIFFKIWP 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 45/120 (38%)
S26_SPase_I 27..136 CDD:119398 44/114 (39%)
IMMP1LNP_001291203.1 sigpep_I_bact 29..149 CDD:274044 48/126 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1211147at2759
OrthoFinder 1 1.000 FOG0001147
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.