DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11110 and Immp2l

DIOPT Version :8

Sequence 1:NP_611501.1 Gene:CG11110 / 37337 FlyBaseID:FBgn0034535 Length:171 Species:Drosophila melanogaster
Sequence 2:XP_002726783.1 Gene:Immp2l / 100359529 RGDID:2323665 Length:175 Species:Rattus norvegicus

Alignment Length:163 Identity:92/164 (56%)
Similarity:120/164 (73%) Gaps:1/164 (1%)


  Fly     3 FRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDE-KDYVFLLRWGTHNSQVERGDI 66
            |:.|.|....|:|:.|||||.|..||||:|.||||:|||...: .|.|.|..|...|.:|:||||
  Rat    12 FKAFCKGFFVAVPVAVTFLDRVVCVARVEGSSMQPSLNPGGSQSSDVVLLNHWKVRNFEVQRGDI 76

  Fly    67 ISLISPKDPAQKIIKRVVGLQGDVVSTLGYKHEIVRVPEGHCWVEGDHTGHSMDSNTFGPVALGL 131
            :||:|||:|.|||||||:.|:||::..:|||:::|:||.||.||||||.|||.|||:||||:|||
  Rat    77 VSLVSPKNPEQKIIKRVIALEGDIIRPIGYKNQLVKVPRGHMWVEGDHHGHSFDSNSFGPVSLGL 141

  Fly   132 MSARAVAIVWPPERWRILENELPRRRRPIQASK 164
            :.|.|..|:||||||:.||:.||..|.|:..|:
  Rat   142 LHAHATHILWPPERWQKLESVLPPERSPVHTSE 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11110NP_611501.1 sigpep_I_bact 27..142 CDD:274044 69/116 (59%)
S26_SPase_I 27..136 CDD:119398 66/110 (60%)
Immp2lXP_002726783.1 sigpep_I_bact 33..152 CDD:274044 70/119 (59%)
S26_SPase_I 36..146 CDD:119398 66/110 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6607
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1211147at2759
OrthoFinder 1 1.000 FOG0001147
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.