DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Mafa

DIOPT Version :10

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001386702.1 Gene:Mafa / 366949 RGDID:1562627 Length:361 Species:Rattus norvegicus


Alignment Length:92 Identity:44/92 - (47%)
Similarity:70/92 - (76%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :||.|||:|||:|||  ::||.::||::|:||:||||||||||.|||.||::|:..||::|....
  Rat   236 SDDQLVSMSVRELNR--QLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQ 298

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKAL 119
            :::||:..:..::.:|...:|.||:.|
  Rat   299 SQVEQLKLEVGRLAKERDLYKEKYEKL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/69 (45%)
coiled coil 51..120 CDD:269865 31/69 (45%)
MafaNP_001386702.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..105
Maf_N 111..141 CDD:462456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..228
bZIP_Maf_large 257..325 CDD:269866 30/67 (45%)
coiled coil 257..325 CDD:269866 30/67 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 262..287 18/24 (75%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 290..311 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..361 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.