DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Nrl

DIOPT Version :10

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001099506.1 Gene:Nrl / 290221 RGDID:1305197 Length:238 Species:Rattus norvegicus


Alignment Length:96 Identity:42/96 - (43%)
Similarity:67/96 - (69%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IPD-ITDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETK 87
            :|: .:|..|||:|||:|||  ::||..|:|.:|:|||||||||||||.:||.||::|:..||.:
  Rat   129 LPERFSDAALVSMSVRELNR--QLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAE 191

  Fly    88 KSYEWTELEQMHEDNEQVRREVSNWKNKYKA 118
            ::....:|:.:..:..::.||    ::.|||
  Rat   192 RARLAAQLDALRAEVARLARE----RDLYKA 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 29/68 (43%)
coiled coil 51..120 CDD:269865 29/68 (43%)
NrlNP_001099506.1 Maf_N 68..102 CDD:462456
bZIP_Maf_large 155..224 CDD:269866 29/68 (43%)
coiled coil 155..224 CDD:269866 29/68 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.