DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment maf-S and Maf

DIOPT Version :10

Sequence 1:NP_001286639.1 Gene:maf-S / 37336 FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001423153.1 Gene:Maf / 17132 MGIID:96909 Length:380 Species:Mus musculus


Alignment Length:93 Identity:41/93 - (44%)
Similarity:72/93 - (77%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEW 92
            :|:.||::|||:|||  ::||:::||::|:||:||||||||||.|||.||::|:..||::|:...
Mouse   259 SDEQLVTMSVRELNR--QLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLL 321

  Fly    93 TELEQMHEDNEQVRREVSNWKNKYKALL 120
            .:::.:.::..::.||...:|.||:.|:
Mouse   322 QQVDHLKQEISRLVRERDAYKEKYEKLV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 29/68 (43%)
coiled coil 51..120 CDD:269865 29/68 (43%)
MafNP_001423153.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..84
Maf_N 86..119 CDD:462456
Represses ARE-mediated transcription. /evidence=ECO:0000250 126..370 41/93 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..244
bZIP_Maf_large 280..348 CDD:269866 29/67 (43%)
coiled coil 280..348 CDD:269866 29/67 (43%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 285..310 18/24 (75%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 313..334 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.