DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: maf-S and Mafb

Sequence 1:NP_001286639.1 Gene:maf-S FlyBaseID:FBgn0034534 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_034788.1 Gene:Mafb MGIID:104555 Length:323 Species:Mus musculus

Alignment Length:122 Identity:52/123 (42%)
Similarity:73/123 (59%) Gaps:20/123 (16%)


  Fly    16 QAPLS-PCPIPDIT-----------------DDDLVSISVRDLNRTLKMRGLNREEIVRMKQRRR 62
            |.|.| |.|.|..|                 ||.|||:|||:|||.|  ||..::|::|:||:||
Mouse   182 QLPTSHPGPGPHATAAATAAGGNGSVEDRFSDDQLVSMSVRELNRHL--RGFTKDEVIRLKQKRR 244

  Fly    63 TLKNRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQVRREVSNWKNKYKAL 119
            ||||||||.|||.||::||..||.:|:....::||:.::..::.||...:|.|.:.|
Mouse   245 TLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKL 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
maf-SNP_001286639.1 bZIP_Maf_small 51..120 CDD:269865 31/70 (44%)
coiled coil 51..120 CDD:269865 31/70 (44%)
MafbNP_034788.1 Maf_N 80..113 CDD:285569
bZIP_Maf_large 233..302 CDD:269866 31/70 (44%)
coiled coil 233..302 CDD:269866 31/70 (44%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 238..263 19/25 (76%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 266..287 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59745722
eggNOG 1 0.900 E1_KOG4196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615211
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.765 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5055
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.