DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9945 and Wsb1

Sequence 1:NP_611494.1 Gene:CG9945 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_062627.3 Gene:Wsb1 MGIID:1926139 Length:421 Species:Mus musculus

Alignment Length:330 Identity:61/331 (18%)
Similarity:119/331 (36%) Gaps:117/331 (35%)


  Fly   175 WSIIDADFSPNGEHFAYSTWSRSLFIMP----------------------------VNGGEDDCQ 211
            |::.   |:|:|.:||:|...|.:.::|                            .|||:.   
Mouse    38 WTVA---FAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQK--- 96

  Fly   212 WIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQILRTHRMPGKDVNSVCFLH 276
                |..|.|.:        ..||.:...:..|:|.....|..|   :..||          |..
Mouse    97 ----NKPPEHVI--------DCGDIVWSLAFGSSVPEKQSRCVN---IEWHR----------FRF 136

  Fly   277 DKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGYHVL-SNSKDQS 340
            .:|..::..|.::|.:|::|:.|       .|.:.:.:.|.:.:..:....||..:| |.|:|::
Mouse   137 GQDQLLLATGLNNGRIKIWDVYT-------GKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKT 194

  Fly   341 IKIWDIRQPSNMRNRSRSRQQVDPTTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLR 405
            :::||::...||....|:.|     .|.|.....|            |.|::             
Mouse   195 LRVWDLKDDGNMVKVLRAHQ-----NWVYSCAFSP------------DCSML------------- 229

  Fly   406 AKFSPMEQTGQRYIYTGCATG---RIIIYDVLTGKIQEAIEGHRTVIRDLDWHPDRSEIVSGSWD 467
                             |:.|   .:.::::....:...:|||...:...|:.||.:.:.:.|:|
Mouse   230 -----------------CSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYD 277

  Fly   468 THVHL 472
            |.|::
Mouse   278 TRVYV 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 58/324 (18%)
WD40 repeat 131..170 CDD:293791
WD40 <133..478 CDD:225201 61/331 (18%)
WD40 repeat 178..220 CDD:293791 13/70 (19%)
WD40 repeat 225..260 CDD:293791 6/35 (17%)
WD40 repeat 270..314 CDD:293791 8/44 (18%)
WD40 repeat 323..395 CDD:293791 17/73 (23%)
WD40 repeat 403..443 CDD:293791 2/43 (5%)
Wsb1NP_062627.3 WD 1 124..165 12/61 (20%)
WD40 135..388 CDD:238121 37/203 (18%)
WD40 <139..382 CDD:225201 37/199 (19%)
WD 2 168..208 11/40 (28%)
WD40 repeat 174..212 CDD:293791 11/38 (29%)
WD 3 212..251 8/86 (9%)
WD40 repeat 217..253 CDD:293791 6/78 (8%)
WD 4 254..293 9/30 (30%)
WD40 repeat 261..299 CDD:293791 7/23 (30%)
WD 5 309..346
WD40 repeat 314..353 CDD:293791
SOCS 382..420 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.