DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9945 and cfap52

Sequence 1:NP_611494.1 Gene:CG9945 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001018475.1 Gene:cfap52 ZFINID:ZDB-GENE-050522-296 Length:617 Species:Danio rerio

Alignment Length:553 Identity:96/554 (17%)
Similarity:179/554 (32%) Gaps:223/554 (40%)


  Fly    42 YCSSEMPVIRG-KPDLV--KFQKTDMYKEIQASSGLVS----NPNNR---------------WNL 84
            |.:|......| |.|::  .::|.::|..:......|.    :||::               || 
Zfish    75 YIASGQVTFMGFKADVIIWDYEKKEIYARLLLHKAKVEDLSFSPNDKYLVSLGGQDDASIVVWN- 138

  Fly    85 VHALQQRENGLASPHSASFSKNQQRYISNLYIPNKKATRLMSLESKIFVTKFNRSGSKLLTACQD 149
               ::.:|....||.||                 :.|...::||       :.....::..:..:
Zfish   139 ---IESKEAICGSPASA-----------------QSAGHCLALE-------YTNLSDEIFVSAGN 176

  Fly   150 GFVRIYDGAKGTYHLLNR-IRARDVEWS----IIDADFSPNGEHFAY-STWSRSLFIMPVNGGED 208
            |.:|:::     ..|||| ||..:.:..    |:.....||.:::.| .|.|..  |:.||    
Zfish   177 GTLRVWE-----LDLLNRKIRPTECQTGQLKRIVKCLEIPNDDNYFYCGTTSGD--ILKVN---- 230

  Fly   209 DCQWIDVNGLPSHRLA------------IFSLRYSPTGDKIIG----------GSNNSTVI---- 247
                     |.:..|:            :.:|:...|||.::|          |:|..|:.    
Zfish   231 ---------LKTRLLSSCGPVKQKFSKGVNTLKVLKTGDILVGSGDGMLTLCSGANFKTIKSVQL 286

  Fly   248 ---VTDIRTR--------NTQILR----------------THRMPGKDV---------------N 270
               ||.:..|        .|:..:                .|....|||               |
Zfish   287 EGGVTSVTLRGDGHQFYVGTEAAQMYSLSYTDFKPELTATNHNSAVKDVAFPFGTSELFATCSHN 351

  Fly   271 SVCFLHDKD---------PNV-------------IIAGCDDGLLKVYDLRTTFRSRDLSKSVASF 313
            .:...|.:.         ||:             |.:..:||.::|:    |..|..|...:.: 
Zfish   352 DIRVWHSESSKELLRITVPNITCHALGFMRDGRSIFSAWNDGKIRVF----TPESGKLKLIIHN- 411

  Fly   314 IGHYDGITYIDSRNDGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQVDPTTWDYRWNRVPREF 378
             .|...:|.|.:.||...::|...:..:::|:|.|.|                  ||        
Zfish   412 -AHSMAVTTIAATNDCKRIVSGGGEGQVRVWEIFQDS------------------YR-------- 449

  Fly   379 YNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIE 443
                       .|.|.:.|:.|...::.|.:..|      ..|..:.|..||:| |...::..:.
Zfish   450 -----------LIETMKEHKATVNCIKIKSNDKE------CVTASSDGACIIWD-LVRFVRNQMV 496

  Fly   444 GHRTVIRDLDWHPDRSEIVS-------GSWDTH 469
            ...|:...:.:||:..:|::       |.|:.:
Zfish   497 LSNTLFSVVCYHPEEYQIITSGTDRKIGYWEVY 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 77/442 (17%)
WD40 repeat 131..170 CDD:293791 8/40 (20%)
WD40 <133..478 CDD:225201 76/441 (17%)
WD40 repeat 178..220 CDD:293791 9/43 (21%)
WD40 repeat 225..260 CDD:293791 12/60 (20%)
WD40 repeat 270..314 CDD:293791 11/66 (17%)
WD40 repeat 323..395 CDD:293791 12/72 (17%)
WD40 repeat 403..443 CDD:293791 8/40 (20%)
cfap52NP_001018475.1 WD40 repeat 23..58 CDD:293791
WD40 59..398 CDD:295369 63/371 (17%)
WD40 repeat 64..106 CDD:293791 7/31 (23%)
WD40 repeat 112..153 CDD:293791 9/62 (15%)
WD40 repeat 158..198 CDD:293791 10/52 (19%)
WD40 164..605 CDD:225201 76/437 (17%)
WD40 repeat 206..246 CDD:293791 10/55 (18%)
WD40 repeat 250..282 CDD:293791 8/32 (25%)
WD40 324..612 CDD:238121 45/257 (18%)
WD40 repeat 333..371 CDD:293791 6/38 (16%)
WD40 repeat 372..412 CDD:293791 7/46 (15%)
WD40 repeat 418..456 CDD:293791 13/75 (17%)
WD40 repeat 461..489 CDD:293791 8/35 (23%)
WD40 repeat 497..538 CDD:293791 6/34 (18%)
WD40 repeat 545..581 CDD:293791
WD40 repeat 587..613 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.