DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9945 and wdr-5.2

Sequence 1:NP_611494.1 Gene:CG9945 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_510394.1 Gene:wdr-5.2 WormBaseID:WBGene00010572 Length:395 Species:Caenorhabditis elegans

Alignment Length:348 Identity:72/349 (21%)
Similarity:139/349 (40%) Gaps:112/349 (32%)


  Fly   130 KIFVTKFN-RSGSKLLTACQDG-FVRIYDGAKGTYHLLNRIRARDVEWSIIDADFSPNGEHFAYS 192
            ::.:.:|: .|.|||:.:|.|. .|:::|.:.|.                               
 Worm   148 RLGINEFSWSSDSKLIVSCSDDKLVKVFDVSSGR------------------------------- 181

  Fly   193 TWSRSLFIMPVNGGEDDCQWIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDIRTRNTQ 257
                             |    |..|..|...:|...::|:|..|..||.:.|:.:...|..|| 
 Worm   182 -----------------C----VKTLKGHTNYVFCCCFNPSGTLIASGSFDETIRIWCARNGNT- 224

  Fly   258 ILRTHRMPGKD--VNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIG-HYDG 319
               ...:||.:  |:||||  ::|...:.:|..||:::::|..|       ...|.:.|. .:..
 Worm   225 ---IFSIPGHEDPVSSVCF--NRDGAYLASGSYDGIVRIWDSTT-------GTCVKTLIDEEHPP 277

  Fly   320 ITYIDSRNDGYHVLSNSKDQSIKIWDIRQPSNMRNRSRSRQQVDPTTWDYRWNRVPREFYNPHKP 384
            ||::....:|.::|:::.:.::|:                       |||:..||.:|       
 Worm   278 ITHVKFSPNGKYILASNLNNTLKL-----------------------WDYQKLRVLKE------- 312

  Fly   385 LEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRIIIYDVLTGKIQEAIEGHRTVI 449
                     |.||..:|..:.|.||   .||.::|.:|....::.|:::.|.:|.:.::||.|.:
 Worm   313 ---------YTGHENSKYCVAANFS---VTGGKWIVSGSEDHKVYIWNLQTREILQTLDGHNTAV 365

  Fly   450 RDLDWHPDRSEIVSGSWDTHVHL 472
            ...|.||.::.|.|.:.:..:.:
 Worm   366 MCTDCHPGQNIIASAALEPDMRI 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9945NP_611494.1 WD40 128..467 CDD:295369 72/342 (21%)
WD40 repeat 131..170 CDD:293791 10/41 (24%)
WD40 <133..478 CDD:225201 72/346 (21%)
WD40 repeat 178..220 CDD:293791 3/42 (7%)
WD40 repeat 225..260 CDD:293791 10/35 (29%)
WD40 repeat 270..314 CDD:293791 11/44 (25%)
WD40 repeat 323..395 CDD:293791 10/72 (14%)
WD40 repeat 403..443 CDD:293791 10/40 (25%)
wdr-5.2NP_510394.1 WWbp <1..87 CDD:304964
WD40 <104..395 CDD:225201 72/349 (21%)
WD40 106..392 CDD:238121 72/349 (21%)
WD40 repeat 110..146 CDD:293791
WD40 repeat 152..188 CDD:293791 13/88 (15%)
WD40 repeat 193..229 CDD:293791 10/40 (25%)
WD40 repeat 236..271 CDD:293791 11/44 (25%)
WD40 repeat 278..314 CDD:293791 12/75 (16%)
WD40 repeat 322..359 CDD:293791 10/40 (25%)
WD40 repeat 365..391 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.