DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nnf1a and Nnf1b

DIOPT Version :8

Sequence 1:NP_611492.1 Gene:Nnf1a / 37325 FlyBaseID:FBgn0034523 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_722652.1 Gene:Nnf1b / 318874 FlyBaseID:FBgn0051658 Length:204 Species:Drosophila melanogaster

Alignment Length:192 Identity:110/193 (57%)
Similarity:149/193 (77%) Gaps:0/193 (0%)


  Fly     2 EDSEAAFKRHEGVGPKVKQAYEEAIKQIFADLSCADLQAWDAIYQEHEQSALDTESIVDRTRSLM 66
            ||:||||||.:.|.|:|||||||||.|||:||:.:||::..:|.:|||.::||||.|:..||.||
  Fly     6 EDTEAAFKRLQAVIPQVKQAYEEAIGQIFSDLNSSDLESCASILEEHESTSLDTEQIIHSTRRLM 70

  Fly    67 TKVVLEMNRCFFASNDVPNKLQTLEMLKEHFAAYEGKKWNVNTAAPDKLTRPLRMRFLDFSVEFM 131
            ||:||::|:|||:.|||..||.|||||||.|||:|||.||.|..:|::|||||||..|:.|:.||
  Fly    71 TKIVLDVNQCFFSGNDVETKLTTLEMLKEQFAAHEGKNWNFNCLSPEELTRPLRMHNLNLSITFM 135

  Fly   132 EQQLASQAKELEIAMAKSNANRERLQHVHDKRLKLTVQMEQQLSQYEKVKTELIKLGEALND 193
            ||||..|.||||||||||..||:.:..||.:|:|:...|:|||::|:.:|.:|:::...:||
  Fly   136 EQQLKKQEKELEIAMAKSIKNRQLIHDVHAERVKVGCMMKQQLAEYQAIKPQLMEMERLIND 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nnf1aNP_611492.1 46 <124..>194 CDD:222878 34/71 (48%)
Nnf1bNP_722652.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140948442
eggNOG 1 0.900 E1_2CEBN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.