DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13423 and BLMH

Sequence 1:NP_611485.1 Gene:CG13423 FlyBaseID:FBgn0034513 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_000377.1 Gene:BLMH HGNCID:1059 Length:455 Species:Homo sapiens

Alignment Length:476 Identity:160/477 (34%)
Similarity:240/477 (50%) Gaps:74/477 (16%)


  Fly    25 LAQNVCTAQDPITVCLR-------SEADLCSVPSGVKTWIELSRQGKATT----GGPGWICTGLD 78
            |||||.|..|.:.:||:       ......:||          ::||..|    .|..||.:.|:
Human    26 LAQNVGTTHDLLDICLKRATVQRAQHVFQHAVP----------QEGKPITNQKSSGRCWIFSCLN 80

  Fly    79 LLCQEMDRKLPLPLDFELSAAHLFFWHKLERCNYFLWTVADLLMRCEPLDGRCFRNLIKNPVPDG 143
            ::.....:||.:. :||.|.::||||.|:|||.:||....|...|.||.|||..:.|:.||..||
Human    81 VMRLPFMKKLNIE-EFEFSQSYLFFWDKVERCYFFLSAFVDTAQRKEPEDGRLVQFLLMNPANDG 144

  Fly   144 GNWQMFVNLVKKYGVMPKKCY--LHSTQRTTKMNLILKSKLREYA----SMLHAQFTFNGNGCRL 202
            |.|.|.||:|:||||:||||:  .::|:.|.:||.||..|:||:.    :::|:..| .|.....
Human   145 GQWDMLVNIVEKYGVIPKKCFPESYTTEATRRMNDILNHKMREFCIRLRNLVHSGAT-KGEISAT 208

  Fly   203 PDLIQEMIPHLFKVICICLGEPPKVFTWSFYDHKKRYQCLNDMTAVHFYEVMVGCTVNLDAFVCL 267
            .|::.|   .:|:|:|||||.||:.|||.:.|..|.||.:..:|.:.||...|....|::..:||
Human   209 QDVMME---EIFRVVCICLGNPPETFTWEYRDKDKNYQKIGPITPLEFYREHVKPLFNMEDKICL 270

  Fly   268 GHDPRISSSYHSNYQVANSSNMMGGKPHRYNNQSMDIIMQIMVTSLEGDKPVWMACDIRRAISLK 332
            .:|||....|:..|.|...|||:||:...||||.:|.:.:::..|::..:.||..||:.:..:.|
Human   271 VNDPRPQHKYNKLYTVEYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSK 335

  Fly   333 SGPLSLRSHQFDLLFGFKVGESLTKAERLDYRASRRDAALLLTSVGLDTLKQPVQFRFINASTIG 397
            .|...:..:..:|:||..: :::.|||||.:..|....|:..|:|.                   
Human   336 LGLSDMNLYDHELVFGVSL-KNMNKAERLTFGESLMTHAMTFTAVS------------------- 380

  Fly   398 ESPATGGLNEHDVDEKVTKALRKKSVKPPDNK------LDAEWLREYAFEIVVHEKFVPSGVLHA 456
                    .:.|.|...|| .|.::....|:.      :..||..||.:|:||..|.||..||..
Human   381 --------EKDDQDGAFTK-WRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAV 436

  Fly   457 ARIHKWKE---LPAWDPMGAL 474
            ..    :|   ||||||||||
Human   437 LE----QEPIILPAWDPMGAL 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13423NP_611485.1 Peptidase_C1 5..472 CDD:304901 157/473 (33%)
BLMHNP_000377.1 Peptidase_C1_2 5..451 CDD:281100 157/473 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229028222
eggNOG 1 0.900 E1_COG3579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1254
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.