DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13423 and blmh

Sequence 1:NP_611485.1 Gene:CG13423 FlyBaseID:FBgn0034513 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001006900.1 Gene:blmh XenbaseID:XB-GENE-997246 Length:453 Species:Xenopus tropicalis

Alignment Length:479 Identity:162/480 (34%)
Similarity:242/480 (50%) Gaps:51/480 (11%)


  Fly     4 LLTEPQWSAWYSAFYASSMNRLAQNVCTAQDPITVCLRSEADLCSVPSGVKTWIE-LSRQGKATT 67
            |.:|||:             .|||||.|..||:.|||:.:    :|...|..:.. :..:||..|
 Frog    17 LKSEPQF-------------LLAQNVATCIDPLEVCLQRQ----TVQDTVHVFQHTIPAEGKPVT 64

  Fly    68 ----GGPGWICTGLDLLCQEMDRKLPLPLDFELSAAHLFFWHKLERCNYFLWTVADLLMRCEPLD 128
                .|..||.:.|:::.....:|..:. :||.|.::||||.|:|||.|||....:.:...||:|
 Frog    65 NQKNSGRCWIFSCLNVMRLPFMKKFNIE-EFEFSQSYLFFWDKVERCYYFLNAFVESVRMNEPVD 128

  Fly   129 GRCFRNLIKNPVPDGGNWQMFVNLVKKYGVMPKKCY--LHSTQRTTKMNLILKSKLREYASMLHA 191
            ||..:.|:.||..|||.|.|.|||::||||:||||:  .|:::.|.:||.||..|:|||...|..
 Frog   129 GRLMQFLLSNPCNDGGQWDMLVNLIEKYGVIPKKCFPESHTSEATRRMNDILNHKMREYCLRLRN 193

  Fly   192 QFTFNGNGCRLPDLIQEMIPHLFKVICICLGEPPKVFTWSFYDHKKRYQCLNDMTAVHFYEVMVG 256
            ..|.:.....:...:..||..:::|:.||||.||...||.|.|.:|.:..:..:|...||:..|.
 Frog   194 MVTSSCTKEEIATALDTMIEEVYRVVSICLGSPPDTITWEFRDKEKNFCKIGPITPQDFYKCHVK 258

  Fly   257 CTVNLDAFVCLGHDPRISSSYHSNYQVANSSNMMGGKPHRYNNQSMDIIMQIMVTSLEGDKPVWM 321
            ...|::..:||.:|||..:.|...|.|....||:||:...||||.:||:.::...|::..:.||.
 Frog   259 PIYNVEDKICLVNDPRPQNQYGKLYTVQFLGNMVGGRRTLYNNQPIDILKRLAALSIKDGEAVWF 323

  Fly   322 ACDIRRAISLKSGPLSLRSHQFDLLFGFKVGESLTKAERLDYRASRRDAALLLTSVGLDTLKQPV 386
            .||:.:....|.|...|.....:|:||..| :::.|||||.|..|....|:.||:| .:.|.|..
 Frog   324 GCDVGKHFHGKLGINDLNIFDHELVFGLSV-KNMNKAERLIYGDSLMTHAMALTAV-TEKLGQDG 386

  Fly   387 QF-RFINASTIGESPATGGLNEHDVDEKVTKALRKKSVKPPDNKLDAEWLREYAFEIVVHEKFVP 450
            :: ::...::.|:.....|.                 :...||     |..||.:|:||.:|.||
 Frog   387 EYEKWRVENSWGDDRGNKGY-----------------LIMADN-----WFSEYVYEVVVDKKHVP 429

  Fly   451 SGVLHAARIHKWKELPAWDPMGAL 474
            ..||... ......||||||||||
 Frog   430 EDVLEVL-TQDPVVLPAWDPMGAL 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13423NP_611485.1 Peptidase_C1 5..472 CDD:304901 158/475 (33%)
blmhNP_001006900.1 Peptidase_C1B 5..450 CDD:238328 159/476 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229027488
eggNOG 1 0.900 E1_COG3579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D308225at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.800

Return to query results.
Submit another query.