DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13423 and blmh

Sequence 1:NP_611485.1 Gene:CG13423 FlyBaseID:FBgn0034513 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_956312.1 Gene:blmh ZFINID:ZDB-GENE-030131-8485 Length:453 Species:Danio rerio

Alignment Length:490 Identity:161/491 (33%)
Similarity:240/491 (49%) Gaps:62/491 (13%)


  Fly     5 LTEPQWSAWYSAFYASSMNRLAQNVCTAQDPITVCLRSEA--DLC-----SVPSGVKTWIELSRQ 62
            |::.:.||:...|.:.....|||||.|..||:.|||..:.  |..     |:|:          :
Zfish     5 LSQEKASAFVKRFRSEPRYLLAQNVSTCIDPLEVCLHRQTVQDTVHIFQHSIPT----------E 59

  Fly    63 GKATT----GGPGWICTGLDLLCQEMDRKLPLPLDFELSAAHLFFWHKLERCNYFLWTVADLLMR 123
            ||..|    .|..||.:.|:::.....:|..:. :||.|.::||||.|:|||.:||....:...|
Zfish    60 GKPVTNQKNSGRCWIFSCLNVMRLPFMKKFNIE-EFEFSQSYLFFWDKVERCYFFLHACVETAQR 123

  Fly   124 CEPLDGRCFRNLIKNPVPDGGNWQMFVNLVKKYGVMPKKCY--LHSTQRTTKMNLILKSKLREYA 186
            .||:|||..:.|:.||..|||.|.|.|||::||||:||||:  .||::.:.:||.||..|:|||.
Zfish   124 KEPVDGRLVQFLLSNPTNDGGQWDMLVNLIEKYGVVPKKCFPESHSSEASRRMNDILNHKMREYC 188

  Fly   187 SMLHAQFTFNGNGCRLPDLIQEMIPHLFKVICICLGEPPKVFTWSFYDHKKRYQCLNDMTAVHFY 251
            ..|............:.:.|..||..:|:|..:|||.||....|.:.|..|.:..|..:|.:.||
Zfish   189 LRLRNMVASESTKTEISETIDTMIEEVFRVASVCLGSPPDTICWEYRDKDKNFHHLGPLTPLEFY 253

  Fly   252 EVMVGCTVNLDAFVCLGHDPRISSSYHSNYQVANSSNMMGGKPHRYNNQSMDIIMQIMVTSLEGD 316
            ...|....||...:||.:|||..:.|...|.|...|||:||:...||||.::::.:....|::..
Zfish   254 TEHVKPLYNLQDKICLVNDPRPQNPYGKLYTVEFLSNMVGGRKTLYNNQPVELLKKAAADSIKKG 318

  Fly   317 KPVWMACDIRRAISLKSGPLSLRSHQFDLLFGFKVGESLTKAERLDYRASRRDAALLLTSVGLDT 381
            :.||..||:.:....|.|...:.....||:||..| ::|:|||||.|..|....|::||:|....
Zfish   319 EAVWFGCDVGKHFHSKLGINDMNVFNHDLVFGVSV-KNLSKAERLIYGDSMMTHAMILTAVTDKV 382

  Fly   382 LKQPVQFRFINASTIGESPATGGLNEHDVDEKVTKALRKKSVKPPDNK----LDAEWLREYAFEI 442
            .|:....::...::.|:...                          ||    :..||..||.:|:
Zfish   383 GKEACYEKWRVENSWGDDRG--------------------------NKGYLIMTDEWFSEYVYEV 421

  Fly   443 VVHEKFVPSGVLHAARIHKWKE---LPAWDPMGAL 474
            ||.:.|:...||...:    |:   ||||||||||
Zfish   422 VVDKSFLSPEVLDVMQ----KDPVVLPAWDPMGAL 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13423NP_611485.1 Peptidase_C1 5..472 CDD:304901 158/487 (32%)
blmhNP_956312.1 Peptidase_C1B 5..450 CDD:238328 158/487 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229030954
eggNOG 1 0.900 E1_COG3579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D308225at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.