DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13423 and Blmh

Sequence 1:NP_611485.1 Gene:CG13423 FlyBaseID:FBgn0034513 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001029335.1 Gene:Blmh RGDID:1304668 Length:455 Species:Rattus norvegicus

Alignment Length:468 Identity:155/469 (33%)
Similarity:238/469 (51%) Gaps:58/469 (12%)


  Fly    25 LAQNVCTAQDPITVCLRSEADLCSVPSGVKTWIE--LSRQGKATT----GGPGWICTGLDLLCQE 83
            |||||.|..|.:.:||:.     :...|.:...:  :.::||..|    .|..||.:.|:::...
  Rat    26 LAQNVGTTHDLLDICLKR-----ATVQGAQHVFQHVVPQEGKPVTNQKSSGRCWIFSCLNVMRLP 85

  Fly    84 MDRKLPLPLDFELSAAHLFFWHKLERCNYFLWTVADLLMRCEPLDGRCFRNLIKNPVPDGGNWQM 148
            ..:|..:. :||.|.::||||.|:|||.:||....|...:.||.|||..:.|:.||..|||.|.|
  Rat    86 FMKKFNIE-EFEFSQSYLFFWDKVERCYFFLNAFVDTAQKKEPEDGRLVQYLLMNPTNDGGQWDM 149

  Fly   149 FVNLVKKYGVMPKKCY--LHSTQRTTKMNLILKSKLREYA----SMLHAQFTFNGNGCRLPDLIQ 207
            .||:|:||||:||||:  .|:|:.|.:||.||..|:||:.    :::|:..| .|......|.:.
  Rat   150 LVNIVEKYGVVPKKCFPESHTTEATRRMNDILNHKMREFCIRLRNLVHSGAT-KGEISSTQDAMM 213

  Fly   208 EMIPHLFKVICICLGEPPKVFTWSFYDHKKRYQCLNDMTAVHFYEVMVGCTVNLDAFVCLGHDPR 272
            |   .:|:|:|||||.||:.|||.:.|..|.|..:..:|.:.||:..|....|::..:|..:|||
  Rat   214 E---EIFRVVCICLGNPPETFTWEYRDKDKNYHKVGPITPLQFYKEHVKPLFNMEDKICFVNDPR 275

  Fly   273 ISSSYHSNYQVANSSNMMGGKPHRYNNQSMDIIMQIMVTSLEGDKPVWMACDIRRAISLKSGPLS 337
            ....|:..|.|...|||:||:...||||.:|.:.:::..|:...:.||..||:.:..:.|.|...
  Rat   276 PQHKYNKLYTVDYLSNMVGGRKTLYNNQPIDFLKKMVAASIRDGEAVWFGCDVGKHFNGKLGLSD 340

  Fly   338 LRSHQFDLLFGFKVGESLTKAERLDYRASRRDAALLLTSVGLDTLKQPVQFRFINASTIGESPAT 402
            :..:..:|:||..: :::.|||||.:..|....|:..|:|                         
  Rat   341 MNVYDHELVFGVSL-KNMNKAERLAFGESLMTHAMTFTAV------------------------- 379

  Fly   403 GGLNEHDVDEKVTKALRKKSVKPPDNK------LDAEWLREYAFEIVVHEKFVPSGVLHAARIHK 461
               :|.|..|......|.::....|:.      :..||..||.:|:||.:|.||..|| |....:
  Rat   380 ---SEKDDQEGAFVKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDKKHVPEEVL-AVLEQE 440

  Fly   462 WKELPAWDPMGAL 474
            ...||||||||||
  Rat   441 PIVLPAWDPMGAL 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13423NP_611485.1 Peptidase_C1 5..472 CDD:304901 152/465 (33%)
BlmhNP_001029335.1 Peptidase_C1_2 5..451 CDD:281100 152/465 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229027319
eggNOG 1 0.900 E1_COG3579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D308225at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10363
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.