DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13423 and Blmh

Sequence 1:NP_611485.1 Gene:CG13423 FlyBaseID:FBgn0034513 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_848760.1 Gene:Blmh MGIID:1345186 Length:455 Species:Mus musculus

Alignment Length:468 Identity:156/469 (33%)
Similarity:239/469 (51%) Gaps:58/469 (12%)


  Fly    25 LAQNVCTAQDPITVCLRSEADLCSVPSGVKTWIE--LSRQGKATT----GGPGWICTGLDLLCQE 83
            |||||.|..|.:.:|||.     :...|.:...:  :.::||..|    .|..||.:.|:::...
Mouse    26 LAQNVGTTHDLLDICLRR-----ATVQGAQHVFQHVVPQEGKPVTNQKSSGRCWIFSCLNVMRLP 85

  Fly    84 MDRKLPLPLDFELSAAHLFFWHKLERCNYFLWTVADLLMRCEPLDGRCFRNLIKNPVPDGGNWQM 148
            ..:|..:. :||.|.::||||.|:|||.:||....|...:.||.|||..:.|:.||..|||.|.|
Mouse    86 FMKKFNIE-EFEFSQSYLFFWDKVERCYFFLNAFVDTAQKKEPEDGRLVQYLLMNPTNDGGQWDM 149

  Fly   149 FVNLVKKYGVMPKKCY--LHSTQRTTKMNLILKSKLREYA----SMLHAQFTFNGNGCRLPDLIQ 207
            .||:|:||||:||||:  .|:|:.|.:||.||..|:||:.    :::|:..| .|......|.:.
Mouse   150 LVNIVEKYGVVPKKCFPESHTTEATRRMNDILNHKMREFCIRLRNLVHSGAT-KGEISSTQDAMM 213

  Fly   208 EMIPHLFKVICICLGEPPKVFTWSFYDHKKRYQCLNDMTAVHFYEVMVGCTVNLDAFVCLGHDPR 272
            |   .:|:|:|||||.||:.|||.:.|..|.|..:..:|.:.||:..|....|::..:|..:|||
Mouse   214 E---EIFRVVCICLGNPPETFTWEYRDKDKNYHKIGPITPLQFYKEHVKPLFNMEDKICFVNDPR 275

  Fly   273 ISSSYHSNYQVANSSNMMGGKPHRYNNQSMDIIMQIMVTSLEGDKPVWMACDIRRAISLKSGPLS 337
            ....|:..|.|...|||:||:...||||.:|.:.:::..|::..:.||..||:.:..:.|.|...
Mouse   276 PQHKYNKLYTVDYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNGKLGLSD 340

  Fly   338 LRSHQFDLLFGFKVGESLTKAERLDYRASRRDAALLLTSVGLDTLKQPVQFRFINASTIGESPAT 402
            :..:..:|:||..: :::.|||||.:..|....|:..|:|                         
Mouse   341 MNVYDHELVFGVSL-KNMNKAERLAFGESLMTHAMTFTAV------------------------- 379

  Fly   403 GGLNEHDVDEKVTKALRKKSVKPPDNK------LDAEWLREYAFEIVVHEKFVPSGVLHAARIHK 461
               :|.|..|......|.::....|:.      :..||..||.:|:||.:|.||..|| |....:
Mouse   380 ---SEKDNQEGTFVKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDKKHVPEEVL-AVLEQE 440

  Fly   462 WKELPAWDPMGAL 474
            ...||||||||||
Mouse   441 PIVLPAWDPMGAL 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13423NP_611485.1 Peptidase_C1 5..472 CDD:304901 153/465 (33%)
BlmhNP_848760.1 Peptidase_C1_2 5..451 CDD:281100 153/465 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229034116
eggNOG 1 0.900 E1_COG3579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1254
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.840

Return to query results.
Submit another query.