DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp99b

DIOPT Version :8

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster

Alignment Length:115 Identity:29/116 (25%)
Similarity:49/116 (42%) Gaps:20/116 (17%)


  Fly    26 TNYVSDCLASNNISQAEFQELIDRNSSEE--DDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDK 88
            |||.:.|:...:.|    :||:::....:  ||...     .|::.|:.:|....||....||.|
  Fly    34 TNYRTQCVEKVHAS----EELVEKYKKWQYPDDAVT-----HCYLECIFQKFGFYDTEHGFDVHK 89

  Fly    89 IDQIEPV--------SDELREILYDCKKIYDEEEDHCEYAFKMVTCLTES 130
            | .|:..        |||:.:.:..|.:.:.:|.|.|..|:....|...|
  Fly    90 I-HIQLAGPGVEVHESDEVHQKIAHCAETHSKEGDSCSKAYHAGMCFMNS 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 27/114 (24%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:279703 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11857
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.